KEGG   Rothia dentocariosa: HMPREF0733_10537Help
Entry
HMPREF0733_10537  CDS       T01343                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00020  Citrate cycle (TCA cycle)
rdn00640  Propanoate metabolism
rdn00660  C5-Branched dibasic acid metabolism
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01120  Microbial metabolism in diverse environments
rdn01130  Biosynthesis of antibiotics
rdn01200  Carbon metabolism
Module
rdn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0733_10537 (sucC)
   00640 Propanoate metabolism
    HMPREF0733_10537 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HMPREF0733_10537 (sucC)
Enzymes [BR:rdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HMPREF0733_10537 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 TauD ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADP39995
UniProt: E3H0Z2
Position
complement(594453..595619)
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQARDLFAKHGVPVLKGIVATTPEEAKAAAEEIGGLTVIKAQVKTGGRGKAGGVK
LAKNPDEAYEYAQQILGMDIKGHTVHRVLVAQGADIAEEYYFSILLDRANRSYLAMCSVE
GGMEIEQLAAERPEALAKVEVDPLVGIDSAKAQEIVEAAGFSAELQPKVVEVLVKLGDVF
NKEDATLVEVNPLVQTPEGDILALDGKVSLDDNAEFRQPDHVALVDKSAENPLEAKAKQH
DLNYVKLDGEVGVVGNGAGLVMSTLDVVAYAGEKHGNVKPANFLDIGGGASAEVMAAGLE
IILGDEQVKSVFVNVFGGITSCDAVAEGIVKALEILGDSATKPLVVRLDGNNVEEGRRIL
SEANHPLVVQATTMDSGADKAAELANKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggaccttttcgaataccaggcgcgcgatctcttcgcaaagcacggtgtacccgtgctc
aagggtattgttgcgaccactcccgaagaagcaaaggcagcagctgaggaaatcggcggc
ctgaccgtcattaaggctcaggttaagaccggtggccgcggtaaggctggcggcgtgaag
ctcgctaaaaaccctgacgaggcatacgagtacgctcagcagattcttggtatggatatc
aagggtcacaccgttcaccgcgtgctggtcgcacagggtgctgacattgctgaagaatac
tatttctcgattctgcttgaccgtgcaaaccgttcgtaccttgccatgtgttcggtagag
ggcggcatggaaattgagcagctcgccgctgaacgccccgaggctctcgccaaggttgag
gtagacccgctggtgggtatcgactccgctaaggcacaggagattgttgaggccgccggg
ttctctgctgaactgcagcccaaggtggttgaggttctcgtgaagctgggcgatgtcttc
aataaggaagacgcaacccttgttgaggttaacccccttgtgcagactcccgaaggcgat
attctggctcttgacggcaaggtctctctcgacgataacgcggaattccgccagcccgat
cacgtggcgcttgtcgataaatccgccgaaaacccgctggaagctaaggctaagcagcac
gacctgaactatgtgaagctcgatggcgaagttggcgttgtcggtaacggcgccggtctg
gtgatgtctactctggatgttgtggcatacgctggcgaaaagcacggcaacgtgaagccc
gccaacttcctcgatatcggtggcggcgcatccgctgaggtcatggctgcgggtcttgag
attattctgggcgatgagcaggttaagagcgttttcgtgaacgtcttcggcggtatcacc
tcgtgcgatgccgtggctgagggcattgtgaaggcgcttgagattctgggcgattccgca
actaagccgcttgtggtgcggttggacggcaataacgtggaggaaggccgccgcatcctc
tctgaggcaaatcacccgctcgtggtgcaggcaaccaccatggattcaggcgccgacaag
gcagcagagctcgctaacaaggcgtaa

DBGET integrated database retrieval system