KEGG   Rothia dentocariosa: HMPREF0733_10623Help
Entry
HMPREF0733_10623  CDS       T01343                                 

Definition
(GenBank) 2-oxo acid dehydrogenase acyltransferase (catalytic domain)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00010  Glycolysis / Gluconeogenesis
rdn00020  Citrate cycle (TCA cycle)
rdn00620  Pyruvate metabolism
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01120  Microbial metabolism in diverse environments
rdn01130  Biosynthesis of antibiotics
rdn01200  Carbon metabolism
Module
rdn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_10623
   00020 Citrate cycle (TCA cycle)
    HMPREF0733_10623
   00620 Pyruvate metabolism
    HMPREF0733_10623
Enzymes [BR:rdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HMPREF0733_10623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADP40081
UniProt: E3H1F4
Position
complement(675717..677207)
Genome map
AA seq 496 aa AA seqDB search
MSQIFNLPDVGEGLTEAEILTWKVSVGSEVSINDVLVEIETAKSVVELPSPYTGTVDKIL
VSEGETIEVGTPIIAISGSAASTADEPQDAPAASADEGESGNQALVGSGPKADSVKRRAR
KRPASARAQNAAPQVQVSPAQEMPVAHTPSSPEPRNQGLFSELAERASKFVENSPFNTVV
QRFQGGAEVPVVTAQPTQEPVPHRPSLAAPPVRLAAKELGVDLANVTATGSRGQVTKQDL
LNYVAHLNDVQESTSQRFWQSPSAPGDRMQHIPVRGVRKATAKAMVSSAFSAPHMSIFVD
VDASRTMEFIKRLKKSRHFEGVKVTPLLVLAAAVIWAAERNPQVNATWTDSEIQIKRFMN
LGIAAATPRGLMVPNIKDAQELSLRELAIALNNLTTRAREGKTQPAEMANGTLTITNIGS
LGIDTGTPIINPGEVAIVAFGTIKQKPWVVDGEVIPRWVTTLGGSFDHRVVDGDLSARFM
ADVAAILEEPAMLLDM
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagatttttaatctcccagacgtgggcgagggtcttaccgaggctgagatcctc
acctggaaagtcagcgttggcagcgaggtcagcattaacgatgttctcgttgaaatcgag
accgccaaatccgttgtggaactgccttcgccctacaccggtaccgtggataagattctg
gtgagcgagggcgagacgatcgaagttgggacgcctattatcgcgatctccggcagtgcc
gcatccaccgcagacgaaccgcaggatgcgcccgccgcatccgctgatgagggcgagagc
ggtaaccaggcactcgtgggttcgggccccaaggccgattcggtgaagcgccgcgcccgc
aagcgccccgcatccgcaagggctcagaacgccgcgccacaggtccaggtttcgcccgct
caggagatgccggtggcgcataccccctcgtcacccgagccgcgcaatcaggggcttttc
agcgagcttgccgagcgtgcctccaaattcgtagaaaacagcccgttcaatacggttgtg
cagcgtttccagggcggggctgaggtacccgtcgtaaccgcacagccgacgcaggagccg
gtgccgcatcgtccgtcgctggcggcgccacctgtacgcttggcggcaaaagagctgggc
gtcgatctggcgaatgtgaccgcgaccggctcgcgcgggcaggtgacgaaacaagacttg
ttgaactatgtggcgcatcttaacgatgtgcaggagtccacgagccagcgtttctggcag
tccccgtccgcaccgggcgaccgtatgcagcatattccggtgcgcggggtgcgcaaggca
accgcgaaggctatggtttcttcggcgtttagcgccccgcacatgtcgatcttcgtagat
gtcgatgcctcgcgcaccatggaatttatcaagcgtttgaagaagtcgcgccacttcgag
ggtgtgaaggtaactccgctgctggtgcttgccgccgccgtgatttgggcggccgaacgg
aacccccaagtgaacgctacgtggacggacagcgagattcagatcaagcgctttatgaac
ttgggcattgcggcggcgaccccgcgcgggctgatggtgccgaatatcaaggacgcgcag
gagctctctctgcgtgagctggcgatcgccttgaataacctgacgactcgcgcccgtgag
gggaagacccagcccgccgagatggcgaatggaaccctgacgattacgaatatcggttcg
cttggtatcgatacagggaccccgattatcaaccccggcgaggtggcaatcgttgccttc
ggcacgattaagcagaagccctgggtggttgatggtgaggttattccgcgctgggtaacc
acgctgggcggttctttcgatcatcgcgtggtagacggcgacctctcggcgcgtttcatg
gcggatgttgccgcgattctcgaagaacccgccatgcttctggatatgtag

DBGET integrated database retrieval system