KEGG   Rothia dentocariosa: HMPREF0733_10712Help
Entry
HMPREF0733_10712  CDS       T01343                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rdn  Rothia dentocariosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0733_10712 (folK)
Enzymes [BR:rdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HMPREF0733_10712 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(770690..771292)
Genome map
AA seq 200 aa AA seqDB search
MDALAHTAVLALGSNLGESETTLEQAAADLVHLSGGAVRLVRASGLYVTEPVGGPADQPD
YINAVLEVRTSLDPYALLALCQQVEAHHHRVRLVRWGPRTLDIDVITYDDLVSDDPVLTL
PHPRAHERAFVLVPWKQANPQAVIPSRDAATGEQTRHLVADLARRVRAADERAGVNAVRF
MRDMNLPKNLFDSGAESEGV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttagcgcatacggcggtgctggccctggggtcaaacctaggcgagagcgaa
accaccctagagcaggccgccgccgacctcgtgcatcttagcgggggtgcagtgcggcta
gtgcgcgcctccgggctgtacgtgacggaaccagtaggcggcccagccgaccagccggac
tatatcaacgccgtccttgaagtgcgcacgagccttgacccctacgcgctgttagcgctg
tgccagcaggtggaggcgcatcatcaccgggtgcggcttgtgcgatggggcccgcgcact
ctcgatattgacgttattacctatgacgacctcgtcagcgacgacccggttctgacgctg
ccgcatccgcgtgcgcatgagcgtgctttcgtactggttccgtggaaacaggcaaacccg
caggcggtaataccgtctcgtgatgccgctacgggcgaacagacgcggcatctcgtcgcc
gatttagctcgcagggtacgcgcagccgatgaacgcgcaggggttaacgcggtacgattt
atgcgagacatgaatttgcccaagaacctatttgatagtggtgctgaaagcgagggcgta
tga

DBGET integrated database retrieval system