KEGG   Rothia dentocariosa: HMPREF0733_10822Help
Entry
HMPREF0733_10822  CDS       T01343                                 

Gene name
gap
Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
rdn  Rothia dentocariosa
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rdn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rdn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rdn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864553..865995
Genome map
AA seq 480 aa AA seqDB search
MTTPENTHEQWIARETQAEEMIPLIGKLNRENGVVLNIHGRSLVNKSVIQLLRLHDGAAK
VDGTPLNPEHTLELVQALFDLNLGPCSINIAALHRQHVDAGSPDFSMWLPEQVGASVGKK
GETVKQQDVVLYGFGRIGRLLARILLERSSSLGANLRLRAVVVRKNTENDLEKRASLLAR
DSVHGPFKGTIKVDAENDTIIANGLPVRFIYSSDPTTVDYTEYGIEDALLVDNTGRWRDV
PGLTQHLERPGISRVLLTAPGKGDMKNIVFGVNDSIITDDDKILSAASCTTNAITPALKV
LDDVYGVERGHVETVHAFTNDQNLIDNFHKGDRRGRSAVLNMVITETGAARAVSKALPQL
EGKLTGNAIRVPTPDVSMAILNVKLAKPAGSKDELNEVFRQVALNGELRRQIGYSDSHEA
VSTDFVGSRNAGVVDALATVVSDDSAILYVWYDNEFGYSCQVVRVLERMAGEEAPSYPTK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgacgactcccgaaaacactcacgagcagtggattgcccgcgaaacccaggccgaagag
atgattcccctcatcggtaagctaaaccgcgagaacggtgtagttcttaatattcacggt
cgcagcctggtcaataagtccgttattcagctgttgcgcctgcatgatggtgccgcgaag
gttgatggaaccccgctgaaccccgagcatacgctagagctggttcaggcactttttgac
cttaaccttggtccctgctcgatcaacattgcggctctgcatcgccagcatgttgatgcg
ggttcccccgacttctccatgtggctgcccgagcaggttggtgcatcggttggcaagaag
ggcgagaccgtcaagcagcaggatgtggtgctctacggtttcgggcgcattggtcgtctg
ttggcgcgtattctgctggagcgttcctcatcgctgggtgcaaacctgcgcctgcgtgcg
gtggtggtgcgtaagaacaccgagaacgatcttgagaagcgggcttctttgttggcacgc
gattcggtgcacggtccgttcaagggcactattaaggtagatgctgagaacgacaccatt
attgctaacggtctgccggtgcgtttcatctactcgtcagatccgaccactgtggattac
accgagtacggtattgaggatgcgcttctggtcgataacaccggtcgctggcgcgatgtt
ccggggctgacccagcaccttgagcgccccggtatttcccgcgttctgctgaccgctccc
ggtaagggcgatatgaaaaatattgtcttcggcgtgaacgatagcatcattaccgacgac
gataagattctttcggcggcatcctgcacgaccaacgcgattacccccgcgctgaaggtt
cttgatgatgtgtacggtgtggaacgcggtcacgtggagaccgtgcacgctttcacgaat
gatcagaacctgatcgataacttccacaagggtgatcgtcgcggccgttcggcagtgctg
aacatggtgattaccgaaaccggcgcggcgcgtgccgtttctaaggcactcccccagttg
gagggcaagctgaccggtaacgctattcgcgttcccaccccggatgtttcgatggctatt
ctgaacgtgaagctggctaagcccgccggttctaaggatgaactgaacgaggtcttccgt
caggttgccctcaacggtgaacttcgccgtcagattggttactccgattcgcatgaggcc
gtctccaccgactttgtgggttcgcgcaacgcgggtgtggtggatgcgcttgccaccgtc
gtcagcgacgactcggcaatcctgtacgtctggtacgacaacgagttcggttactcctgc
caggtggtgcgcgtgttggaacgtatggctggcgaagaggcaccttcataccccacaaaa
taa

DBGET integrated database retrieval system