KEGG   Rothia dentocariosa: HMPREF0733_11149Help
Entry
HMPREF0733_11149  CDS       T01343                                 

Gene name
acs
Definition
acetate-CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rdn  Rothia dentocariosa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0733_11149 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_11149 (acs)
   00620 Pyruvate metabolism
    HMPREF0733_11149 (acs)
   00640 Propanoate metabolism
    HMPREF0733_11149 (acs)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0733_11149 (acs)
Enzymes [BR:rdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HMPREF0733_11149 (acs)
Lipid biosynthesis proteins [BR:rdn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HMPREF0733_11149 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1237631..1239787)
Genome map
AA seq 718 aa AA seqDB search
MGDTVGLPSPFSFTNPLAPTPNPAHESDEARVAFWEKQAERLTWGKTWDNAHTFQKPQVI
GTDAEGIEEYSVPEIKWFEGGKLNVAYNCVDRHVDAGRGDKVALYFEGEPGDREAITYAE
LQRRIARAANGLLKLGVRKGDRVVIYLPVIPETIIFTLACARIGAIHSLVFGGFSAEALK
FRVEDTGAKVLITTDGQNRRGKVVPVKVNADEACSGENNIEHVIVVDRTSAADPVAHAQV
PWTTGRDIWYHDLVDDQPDTHEYELHDAEDPLFIIYTSGTTGKPKGLVHTMAGYLVQTAY
THALLYDLLPDYVDEDGVLRPDELSAVNDPAKVESTVHWCTADLAWVTAHTYEIYGPLVN
GVTEVIFEGTPNTPHYGRHFEVIERYGVTNYYTAPTLIRSLMGAFPDGPEPGKYDFSSVR
LLGSVGESINPQAWKWLRKHVGGGTASFIDTWWQSETGSTICSPRPHDPAFAPEGTFPEG
TPHCTPLPGCATREVPGVSVRVVDEHGDLVEPGKQGFIVVDKIGPSMARTVWGDPQRYLN
SYWKHYGTRGWFLAGDGAKVDDEGNVYILGRIDDVINISGHRLSTIEIESALVTHPAVVE
AGVCPVEDELTGHQAVAYVTLTDKGQALTEDELKTVLTQHVREHIGPIAKPKDVVAVADI
PKTRSGKITRRLLGELYQGHKLGDISSLQNEEALGAIAQVLVDTGRVDPDAFTEDQAA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgggagatactgtgggacttccctcccctttttcattcacgaatcctctagcacccacc
cccaaccccgcgcacgaatctgacgaggcgcgggtagcgttctgggaaaaacaagccgag
cgcctaacctggggcaagacttgggacaacgcgcataccttccagaaaccgcaggtcatc
ggaaccgatgctgagggcatcgaagaatactccgtacccgagattaagtggttcgagggc
ggcaaactcaacgtcgcctacaactgcgtggaccgccacgtggatgcgggccgcggcgac
aaagtagccctctatttcgagggcgaacccggcgaccgtgaagctatcacctacgctgaa
ctgcagcgacgcatcgcccgcgccgccaacggcctgctcaaactcggcgtgcgtaaaggc
gaccgtgtagtaatctacctgccggttattcccgaaaccattatcttcacgcttgcgtgc
gcgcgcatcggcgcaattcactcactcgtatttggtggattctcggcggaggctctgaaa
ttccgggtggaagacaccggcgcgaaagttctgatcaccaccgacgggcagaaccgccgc
ggcaaggtcgtgcccgtgaaggtgaacgccgatgaagcctgctcgggtgagaataatatc
gagcatgtgatcgtggtggaccgtacaagcgccgcagaccccgtggcgcacgcgcaggtt
ccttggacgaccgggcgcgatatttggtaccacgacctggtagacgatcagcccgatacc
catgagtacgagctgcacgatgccgaggacccgctgtttatcatttatacctctggcacc
acgggcaaacccaagggcctggtgcacacaatggcggggtatttagtgcagaccgcatac
acccacgcgctgctgtacgatctgctgccggactatgtggatgaagacggggtgctgcgc
cccgatgagctgtctgccgtgaacgacccggcgaaggttgaatcgactgtgcactggtgt
accgccgatctcgcgtgggtgaccgcgcacacctacgaaatctatggtccactcgtgaat
ggggttaccgaggttattttcgagggcacccccaatactccgcattacggccgtcatttc
gaggttatcgaacgctacggcgtcaccaattattacaccgctcccaccctgattcgttcc
ctcatgggggcgttccctgacggccccgaacccggaaaatacgatttctcttccgtgcgt
ctgctcggatctgtgggcgagtccattaaccctcaggcctggaagtggctgcgcaagcac
gtgggtgggggtaccgcatcgtttatcgatacatggtggcagtccgaaaccggctcaacc
atctgctccccacgaccacatgaccccgccttcgcgcccgaggggaccttccccgagggc
accccgcactgcactccccttcccggatgcgccacccgcgaagtcccgggcgtctcggtg
cgcgtggtggacgagcacggtgacctcgttgagcccggcaaacagggtttcattgtggtc
gataagatcggcccctccatggcacgcaccgtctggggcgacccgcaacgctacctgaat
tcctattggaagcactacggtacgcgcggctggttcctcgccggtgacggtgcgaaggtc
gatgatgagggcaacgtgtacatcctggggcgcatcgacgatgtgatcaacatttccggg
caccgcctttcgaccatcgaaattgagtctgcgctcgtgacgcacccggccgtggtggag
gctggcgtgtgccccgtggaggacgagctaaccggccaccaggcagtcgcctatgtgacg
ctcaccgacaaaggtcaggcactcaccgaagacgagctgaaaactgtgctcacccagcat
gtgcgcgaacatattggccctatcgctaagcccaaggatgtggtcgcggtcgccgatatt
cctaagactcgttcagggaagattacccgccgtctgctgggcgagctctaccaggggcat
aagctgggcgatatttcttcgcttcagaatgaggaggcgctcggcgctatcgcacaggtg
ctcgtagacaccgggcgagtagacccagatgcgttcaccgaggatcaggcggcataa

DBGET integrated database retrieval system