KEGG   Rothia dentocariosa: HMPREF0733_11149Help
Entry
HMPREF0733_11149  CDS       T01343                                 

Definition
(GenBank) putative acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00010  Glycolysis / Gluconeogenesis
rdn00620  Pyruvate metabolism
rdn00640  Propanoate metabolism
rdn00680  Methane metabolism
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01120  Microbial metabolism in diverse environments
rdn01130  Biosynthesis of antibiotics
rdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_11149
   00620 Pyruvate metabolism
    HMPREF0733_11149
   00640 Propanoate metabolism
    HMPREF0733_11149
  Energy metabolism
   00680 Methane metabolism
    HMPREF0733_11149
Enzymes [BR:rdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HMPREF0733_11149
Lipid biosynthesis proteins [BR:rdn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HMPREF0733_11149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADP40606
UniProt: E3H4A3
Position
complement(1237631..1239787)
Genome map
AA seq 718 aa AA seqDB search
MGDTVGLPSPFSFTNPLAPTPNPAHESDEARVAFWEKQAERLTWGKTWDNAHTFQKPQVI
GTDAEGIEEYSVPEIKWFEGGKLNVAYNCVDRHVDAGRGDKVALYFEGEPGDREAITYAE
LQRRIARAANGLLKLGVRKGDRVVIYLPVIPETIIFTLACARIGAIHSLVFGGFSAEALK
FRVEDTGAKVLITTDGQNRRGKVVPVKVNADEACSGENNIEHVIVVDRTSAADPVAHAQV
PWTTGRDIWYHDLVDDQPDTHEYELHDAEDPLFIIYTSGTTGKPKGLVHTMAGYLVQTAY
THALLYDLLPDYVDEDGVLRPDELSAVNDPAKVESTVHWCTADLAWVTAHTYEIYGPLVN
GVTEVIFEGTPNTPHYGRHFEVIERYGVTNYYTAPTLIRSLMGAFPDGPEPGKYDFSSVR
LLGSVGESINPQAWKWLRKHVGGGTASFIDTWWQSETGSTICSPRPHDPAFAPEGTFPEG
TPHCTPLPGCATREVPGVSVRVVDEHGDLVEPGKQGFIVVDKIGPSMARTVWGDPQRYLN
SYWKHYGTRGWFLAGDGAKVDDEGNVYILGRIDDVINISGHRLSTIEIESALVTHPAVVE
AGVCPVEDELTGHQAVAYVTLTDKGQALTEDELKTVLTQHVREHIGPIAKPKDVVAVADI
PKTRSGKITRRLLGELYQGHKLGDISSLQNEEALGAIAQVLVDTGRVDPDAFTEDQAA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgggagatactgtgggacttccctcccctttttcattcacgaatcctctagcacccacc
cccaaccccgcgcacgaatctgacgaggcgcgggtagcgttctgggaaaaacaagccgag
cgcctaacctggggcaagacttgggacaacgcgcataccttccagaaaccgcaggtcatc
ggaaccgatgctgagggcatcgaagaatactccgtacccgagattaagtggttcgagggc
ggcaaactcaacgtcgcctacaactgcgtggaccgccacgtggatgcgggccgcggcgac
aaagtagccctctatttcgagggcgaacccggcgaccgtgaagctatcacctacgctgaa
ctgcagcgacgcatcgcccgcgccgccaacggcctgctcaaactcggcgtgcgtaaaggc
gaccgtgtagtaatctacctgccggttattcccgaaaccattatcttcacgcttgcgtgc
gcgcgcatcggcgcaattcactcactcgtatttggtggattctcggcggaggctctgaaa
ttccgggtggaagacaccggcgcgaaagttctgatcaccaccgacgggcagaaccgccgc
ggcaaggtcgtgcccgtgaaggtgaacgccgatgaagcctgctcgggtgagaataatatc
gagcatgtgatcgtggtggaccgtacaagcgccgcagaccccgtggcgcacgcgcaggtt
ccttggacgaccgggcgcgatatttggtaccacgacctggtagacgatcagcccgatacc
catgagtacgagctgcacgatgccgaggacccgctgtttatcatttatacctctggcacc
acgggcaaacccaagggcctggtgcacacaatggcggggtatttagtgcagaccgcatac
acccacgcgctgctgtacgatctgctgccggactatgtggatgaagacggggtgctgcgc
cccgatgagctgtctgccgtgaacgacccggcgaaggttgaatcgactgtgcactggtgt
accgccgatctcgcgtgggtgaccgcgcacacctacgaaatctatggtccactcgtgaat
ggggttaccgaggttattttcgagggcacccccaatactccgcattacggccgtcatttc
gaggttatcgaacgctacggcgtcaccaattattacaccgctcccaccctgattcgttcc
ctcatgggggcgttccctgacggccccgaacccggaaaatacgatttctcttccgtgcgt
ctgctcggatctgtgggcgagtccattaaccctcaggcctggaagtggctgcgcaagcac
gtgggtgggggtaccgcatcgtttatcgatacatggtggcagtccgaaaccggctcaacc
atctgctccccacgaccacatgaccccgccttcgcgcccgaggggaccttccccgagggc
accccgcactgcactccccttcccggatgcgccacccgcgaagtcccgggcgtctcggtg
cgcgtggtggacgagcacggtgacctcgttgagcccggcaaacagggtttcattgtggtc
gataagatcggcccctccatggcacgcaccgtctggggcgacccgcaacgctacctgaat
tcctattggaagcactacggtacgcgcggctggttcctcgccggtgacggtgcgaaggtc
gatgatgagggcaacgtgtacatcctggggcgcatcgacgatgtgatcaacatttccggg
caccgcctttcgaccatcgaaattgagtctgcgctcgtgacgcacccggccgtggtggag
gctggcgtgtgccccgtggaggacgagctaaccggccaccaggcagtcgcctatgtgacg
ctcaccgacaaaggtcaggcactcaccgaagacgagctgaaaactgtgctcacccagcat
gtgcgcgaacatattggccctatcgctaagcccaaggatgtggtcgcggtcgccgatatt
cctaagactcgttcagggaagattacccgccgtctgctgggcgagctctaccaggggcat
aagctgggcgatatttcttcgcttcagaatgaggaggcgctcggcgctatcgcacaggtg
ctcgtagacaccgggcgagtagacccagatgcgttcaccgaggatcaggcggcataa

DBGET integrated database retrieval system