KEGG   Rothia dentocariosa: HMPREF0733_11256Help
Entry
HMPREF0733_11256  CDS       T01343                                 

Definition
phosphoprotein phosphatase
Organism
rdn  Rothia dentocariosa
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1365562..1368021
Genome map
AA seq 819 aa AA seqDB search
MARKIFLLAGAAGAGKSTWIAAHPELADLTHSWDAERRKCGYITYTLDNQPALALSQNTS
AESKAIRRVNDCVEENMRHGNTVFIDNMNVLLRNMKTFLEFARKYCYTAYLVDFQGELTL
DELYARNRTREYTKRVPEEVIETAYNNHRELRENWRSILKNYRDVVAGYIAPNQVFTELF
TPVRALDNYHKVVVVGDIQGMGGELEKLIDTLSPETGLSDENICWIFAGDLFDRGQNPEK
VFDILEPALGTLPNVHLVMGNHERSIMHTIRGVRRYRDARETLDALAAHGVYNSRVITML
NTAVNMMPFTLGQERYFVTHAGVAPQLFADSHRTLEGVGEGYLTGLYADETFYLGSNPYS
QARAGKTQYAGYEETLNDLNRVAGITQIYGHRPAALGSEGYSNLIPLESSVEFTGGELSA
VVFSREDSASGAPEKALWKREIVKIPSSSLIPDPYASGSRTAGASKNAANGAAEPLNDGH
RLLEEMRANPNVNVRATEPAGVLACNFTRKAFYKGAWDKTTAKARGLFIHAETGKIVGRG
YEKFFNMDEPGHESEAQVRKRLAYPAIARAKENGYLAIITVFDGMLAVYSKSGVTAYSRH
AESILHAALTQEERARLTEALTRMDSSLTVEVVDPFRDPHIVPYEHVTLYLLDLIANTAQ
FRVKPARFEDLWLSPKAFAQPRPTEEHGPVRISTVEEIPLKDDADFTRLLQEARTSNAEG
WVIRDSTGYMVKIKAPGYSATKRARAIPALVDYLREPSEQRRGTQADREKLERNAERLGL
NLSDYIVSTISRHYTWDLPRLAPHLKDLLHGVNTHGRLD
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaaatcttcctcttagccggtgcggcgggtgccggtaagagcacctggatc
gccgcgcatcccgaacttgcagacctgacgcattcttgggatgccgagcgccgcaaatgc
ggatacatcacctacacgctcgataatcaacccgcattagccctatcacaaaacaccagc
gccgaatcgaaggctatccgccgggtgaacgactgcgtggaagaaaatatgcggcacggc
aacaccgtatttatcgacaatatgaacgtgctgctgcgcaacatgaaaaccttcctcgaa
tttgcgcgcaaatactgctacaccgcatacctggtcgattttcagggcgaactcaccctc
gacgagctgtatgcgcgcaacagaacccgcgaatacaccaagcgcgtacccgaagaggtt
atcgagaccgcctacaacaaccaccgtgagctgcgcgagaactggcgcagcatcctcaag
aactaccgagatgtggtcgccgggtacatcgcccccaaccaggtttttaccgagctcttc
accccggtgcgtgcgctcgataactaccataaagtagtcgtagtcggcgatattcagggc
atgggcggtgaactcgaaaaactcatcgacactctctcacccgaaaccgggctgagcgat
gaaaacatctgctggatattcgccggtgacctcttcgatcgcgggcaaaaccccgaaaaa
gtctttgacattcttgaacccgcccttggcaccctgcccaatgtgcacctcgtgatgggc
aaccatgaacgctccatcatgcacactattaggggcgtgcgccgctaccgtgatgcccgc
gaaaccctggatgcgctcgccgcccacggcgtgtacaacagccgggtgatcaccatgctc
aacaccgccgtgaatatgatgccctttactctcgggcaggagcgttatttcgtgacccac
gccggggttgcgccgcagctctttgcggattcccatcgcacgctggaaggggtgggggag
gggtacctcacggggctgtatgcagatgaaacgttctatttgggttctaatccgtactcg
caggcgcgggcgggtaaaacccagtacgcaggctacgaagagacgctcaatgacctgaac
cgggtcgccggtatcacccaaatttacggtcaccgcccggcggcactcggttcggaagga
tacagtaatctcattccgttagaaagcagcgtcgaatttaccggcggcgagctgagcgcc
gtggtgttcagccgcgaggacagcgcatccggtgcacccgagaaagccttatggaagcgc
gaaatcgtgaaaattccatcgagctccctcatccccgatccttacgcctcggggagtaga
acggcgggcgcctcaaaaaacgctgcaaacggtgccgcagaacccctcaacgacgggcat
cgcctgctagaggagatgcgcgctaaccccaacgtgaacgtgcgcgccaccgaacctgcg
ggagtactcgcgtgcaatttcacgcgcaaagccttctacaaaggcgcctgggataagacc
accgccaaagcgcgcgggctctttatccacgccgaaaccggcaaaattgtggggcgcgga
tacgaaaaattcttcaatatggacgagcccgggcatgagagcgaggcacaagttcgcaaa
cgcctcgcctacccggccattgcacgcgccaaagaaaacggatacctagcgattatcacg
gttttcgacggcatgctcgccgtctacagcaagagcggggtaaccgcctacagccgccac
gccgaaagtatcctgcacgccgccctcacccaggaagaacgcgcccggctcaccgaagcg
ctcacccgtatggattcatcactaacagttgaggtggtcgatccgttccgcgacccgcac
atcgtgccctacgaacacgtcacgctctatctgctcgatctgattgcgaacaccgcgcag
ttcagggtgaaaccggcccgctttgaagacctgtggctctcgccgaaagccttcgcgcag
ccgcgccccaccgaggagcacggccccgtgcgtatttctacggtcgaagaaattcccctc
aaagacgacgccgatttcacccgcctgctccaggaagcgcgtacaagcaacgctgagggc
tgggttatccgtgactctacgggctatatggtcaaaatcaaggcgcccgggtactctgcc
acgaaacgcgcccgcgcgattcccgcgctggtggactacctgcgcgagccatccgaacag
cgcaggggtacccaagccgaccgtgagaagctggaacgcaacgccgaacgcctggggctg
aacctcagcgactatattgtctccaccatcagcaggcactatacatgggatttaccgcgg
ttggcaccgcatctaaaagacctgctgcacggcgtcaacacgcacggacggctggactag

DBGET integrated database retrieval system