KEGG   Rothia dentocariosa: HMPREF0733_11263Help
Entry
HMPREF0733_11263  CDS       T01343                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rdn  Rothia dentocariosa
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0733_11263 (gpm)
   01230 Biosynthesis of amino acids
    HMPREF0733_11263 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_11263 (gpm)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0733_11263 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0733_11263 (gpm)
Enzymes [BR:rdn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0733_11263 (gpm)
Exosome [BR:rdn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0733_11263 (gpm)
  Exosomal proteins of melanoma cells
   HMPREF0733_11263 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373664..1374437
Genome map
AA seq 257 aa AA seqDB search
MTNRRPHEKIEAMTYKLVLLRHGQSEWNEKNLFTGWVDVNLTDKGRAEAQRGGELLKERG
ILPDIVHTSLQRRAINTANIALDAADRLWIPVKRTWRLNERHYGALQGKNKSEIREEYGD
EKFMTWRRSYDVPPPPLDDSDPYSQANDPRYADVENAPRTECLKDVLGRMLPYWESDIKP
DLADGKTVLVAAHGNSLRSLVKHLENISDEDIAGLNIPTGIPLYYELDENFKPLKPGEYL
DPEAAKDAIAAVANQGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgccgcccgcatgaaaaaatagaagctatgacatacaaattagtactcctg
cgtcacggccagtcggagtggaacgagaagaacctgttcaccggctgggtcgatgttaat
ctgactgataagggtcgtgctgaggctcagcgcggcggcgaactactgaaagaacgcggc
atccttcccgatattgtgcacacctcattgcagcgccgcgctatcaacaccgcaaatatt
gccctggatgcggccgaccgcctctggattccggtcaagcgtacctggcgtctgaacgaa
cgtcactacggcgctctgcagggtaagaacaagtctgagatccgtgaagaatacggtgac
gagaagttcatgacttggcgtcgttcctacgatgtgccacctccgccgctggacgatagc
gacccctactcgcaggcaaacgatccccgctacgcggatgttgagaacgcaccccgcacc
gagtgcctcaaggacgttctcggtcgtatgcttccgtactgggaatccgatattaagccc
gaccttgccgacggtaagactgtgctggtcgcggcgcacggtaactccctgcgctcgctt
gtgaagcatttggagaacatctccgatgaggatatcgctgggttgaacattccgaccggc
attccgctgtactacgagctggacgagaactttaagcctctcaagccgggcgagtacctt
gaccctgaagctgcgaaggatgctatcgcggctgttgcaaaccagggtaagtaa

DBGET integrated database retrieval system