KEGG   Rothia dentocariosa: HMPREF0733_11360Help
Entry
HMPREF0733_11360  CDS       T01343                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b small subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rdn  Rothia dentocariosa
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0733_11360 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0733_11360 (sdhD)
   00650 Butanoate metabolism
    HMPREF0733_11360 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HMPREF0733_11360 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1482470..1482955
Genome map
AA seq 161 aa AA seqDB search
MSTPLKSRVSVPRLRDNKIDGVKYNRSSSKRNNFEMFAWLGMRLSGVVLVVLIFGHLFVN
LMVGDGIHAIDFGFVGGKWANPFWQIWDLLLLWLAMLHGTNGIRVVIDDYAEKDRVRVWL
KIILFAASAFVLLVGTLTIFAFDPCPSGAAANLLPSFCPAH
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtctactccactcaaatcacgcgtttcggttcctcgcctgcgcgataacaagattgat
ggtgtgaaatataaccgctcctccagcaagcgcaacaactttgaaatgttcgcctggctg
gggatgcgcctctccggcgtcgtgttggttgtcctgattttcgggcacctctttgtgaac
ctcatggtgggggacggcattcacgcgatcgacttcggcttcgtgggcggtaaatgggca
aaccccttctggcaaatctgggatctgctgctgctgtggctggctatgctccacggcacc
aacggcatccgcgtggtcattgacgactacgccgaaaaggatcgtgtgcgtgtgtggctg
aagatcattctcttcgcagcatccgcttttgtgctgctggttggaaccctcacgatcttt
gcttttgatccctgcccctcgggcgcggcggctaatctgctgcctagcttctgcccggcc
cactaa

DBGET integrated database retrieval system