KEGG   Rothia dentocariosa: HMPREF0733_11654Help
Entry
HMPREF0733_11654  CDS       T01343                                 

Definition
monoglyceride lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rdn  Rothia dentocariosa
Brite
Enzymes [BR:rdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HMPREF0733_11654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1829427..1830290)
Genome map
AA seq 287 aa AA seqDB search
MNIFENAGEPLRRIRRQAHQRRELAVQPSTMRVQNSLESEFNHDPISHPADRELYEGDVG
LLIIHGFTGSPHSMRPIADHFIKLGYPVEMPRLAGHGTHWRDMVATEYKEWVDGVEEGYW
KLLNAGYRVIVIGISMGGCIATNLAARHDVLGMVLINPYFVDVNPMMKVAHRVAPIFPSL
KSVGSDIARPGVDEGAYPRTPTVSVRQLHLLGRETRELIPLLRAPVLYLRSLHDHVVSDS
SHRYFLEHCSAPVNFKWLTHSYHVPTLDYDAELILSVIQDFVVDCEA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttcgagaatgcaggtgaaccgttgcgccgcatccgccgtcaggcacatcag
cgtcgtgagcttgccgtccagccctcaacaatgcgtgtgcaaaactctttagagtcggag
ttcaaccacgatcctatttcccatccggctgaccgtgaactctatgagggtgatgttggc
cttctcatcattcatggcttcacaggatccccgcacagtatgcgacctatagcagatcac
tttattaagctcggctaccctgttgagatgcctcgtcttgctgggcatggcacacactgg
cgagacatggtggcgaccgagtataaagagtgggttgatggtgtcgaagaaggatattgg
aaactcctcaatgcaggctatcgggttatcgtaatcggtatttctatgggcgggtgcatt
gctaccaatttagcggctcggcatgatgttctaggcatggtgctcattaacccctatttt
gtggatgtaaaccccatgatgaaagtggcacaccgagttgcccctatatttccttcgctc
aagtctgttggatctgacattgcccgtcctggagttgatgaaggtgcatatccacgaact
cctaccgtttctgtacggcagcttcaccttttgggccgagagactcgtgagctgataccc
ttgctacgggctccggtgctttatctgcgttccctccacgatcatgttgtctcagatagt
tcgcaccgctattttctagaacactgctcagcaccggtaaactttaaatggttgactcac
agttaccatgtgccgactctagactacgacgcggaacttatcttatccgtgatacaagat
tttgtcgttgactgtgaagcataa

DBGET integrated database retrieval system