KEGG   Rothia dentocariosa: HMPREF0733_11685Help
Entry
HMPREF0733_11685  CDS       T01343                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00010  Glycolysis / Gluconeogenesis
rdn00520  Amino sugar and nucleotide sugar metabolism
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01120  Microbial metabolism in diverse environments
rdn01130  Biosynthesis of antibiotics
rdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_11685 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0733_11685 (ppgK)
Enzymes [BR:rdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     HMPREF0733_11685 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADP41142
UniProt: E3H154
Position
complement(1867526..1868401)
Genome map
AA seq 291 aa AA seqDB search
MNETTAAIPPVENSVEYVDVPAPTPKDLMIGIDIGGTGMKGGIVDLRTGNLVSERFRIPT
PQPATPQAIAQVARQIVDELQSREIAPEPYSAIGVDFPAVVKNGVVFSAANVDPAWINTN
LEQLISDALDSRTVYGINDADAAGLAEATYGQGRDKTGLIAVITLGTGIGSALINNGVLV
PNTELGHLEIDGYDAESRASARAREVHDLSWKKYAKKRLRRYFQHVEALFSPDLFIIGGG
ISKNPEKFMPYFEDEIRTPMVMATLRNNAGIVGAALWAGGMPSERQRRGEL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagactactgctgcaattcctccggtcgaaaactcggtagaatacgtcgatgtt
ccggcgcccacccccaaagacctgatgatcggtattgatattggcggtaccggtatgaaa
ggcggtatcgtcgatctgcgaaccggtaacctggtatccgagcgttttcgtattcccacc
ccgcagccagcaaccccacaggctatcgcacaggtggcacgccagattgttgatgagctt
caatcacgtgagatagcgccagagccttattctgctatcggcgtcgatttccccgccgtt
gtgaagaatggtgtggttttctcagctgcaaatgttgatcccgcctggattaacactaac
cttgagcagctcatcagcgacgctctggattcaaggactgtttacggcattaatgatgct
gatgccgcaggtcttgccgaagccacctacgggcaaggacgagacaagacggggctcatc
gccgttatcactttaggaaccggtattggttccgccctgattaacaacggggttttggta
ccgaacaccgaactcggacaccttgaaattgacgggtatgatgcggagtcccgcgcatcc
gcgcgagcacgcgaagttcatgatctttcgtggaagaagtacgccaaaaagcgtctgcgc
cggtatttccagcatgttgaagcgttgttctcccctgaccttttcattattggtggaggc
atctcaaagaaccccgaaaaatttatgccctacttcgaggacgagattcgtacccctatg
gtgatggcgactctgcgcaataatgcaggcatcgtgggcgctgcgctttgggctggcgga
atgccttccgaacgtcagcggcgcggcgaactctaa

DBGET integrated database retrieval system