KEGG   Rothia dentocariosa: HMPREF0733_11707Help
Entry
HMPREF0733_11707  CDS       T01343                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rdn  Rothia dentocariosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0733_11707 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0733_11707 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0733_11707 (thrC)
Enzymes [BR:rdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0733_11707 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1895152..1896252
Genome map
AA seq 366 aa AA seqDB search
MAHVWQGVINEYRDRLPFGDEVKPVTLGEGGTPLIHAPALSAQTGNTVYLKFEGMNPTGS
FKDRGMTSAITAAKREGAKAVVCASTGNTSASAAAYALQAGMRCAVLVPDGKISMGKLSQ
AIAHGADIIQIDGNFDNCLEIARKLSENYPVFLVNSVNPYRIEGQKTGSFEVVDTLGDAP
DYHLLPVGNAGNITAYWKGYKEYSEPYTNRDGKVLEPVATKRPIMWGFQAAGAAPIVAGH
PIDTPETIATAIRIGNPASWEKAEAARDESGGVIEAVTDEEILEAHRWLSSREGVFVEPA
SAAGVAGLLKKHRAGEAPEGKTIVITVTGHGLKDPQWALEPVNGAKVEPTKAAFDVVAVA
DILDLN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcacatgtgtggcagggcgtcattaacgaataccgcgatcgtcttccgttcggggac
gaggtaaaaccggtaactctaggcgaaggcggaaccccgctgattcacgcaccggcgctg
tcagcgcagactggcaatacggtatacctcaaattcgaggggatgaaccccaccggatct
ttcaaagaccgcggcatgacgagcgctattactgccgctaaacgcgaaggtgcgaaggct
gttgtgtgcgcttcgaccggtaatacttcagcgtcggcagcggcatatgcgcttcaagcg
gggatgcgctgcgcggtactcgtgccggacggcaagatttcgatgggcaaactctcgcag
gccatcgcccacggcgctgatattattcagattgacggaaacttcgataactgcctcgaa
attgcccgtaaactcagcgagaattacccagtattcttggtgaactcggtgaacccctac
cgcattgagggtcagaagaccggttcttttgaggtcgtcgacaccctgggagatgccccc
gattaccatctgctcccggtaggtaacgcgggcaatattaccgcttattggaaggggtac
aaggagtattccgagccctatacgaaccgtgacggcaaggtcctagagccggtcgccacc
aagcgacccatcatgtggggtttccaagcagctggcgcggccccgattgttgcagggcac
ccgattgacactcccgaaacgattgcgaccgcaattcgcatcggtaaccctgcctcatgg
gagaaagctgaagcggcacgcgacgaatccggcggcgtgattgaagctgtcaccgatgag
gagattcttgaggcgcaccgctggctctcttcccgcgagggcgttttcgttgagcccgct
tcagccgctggtgttgcgggtctgctcaagaaacatcgcgcgggtgaggctcccgagggc
aagaccattgtcattacggtgacgggtcacggtttgaaggatccgcagtgggcgctggaa
ccggtcaacggtgcgaaagttgaaccgactaaggcagccttcgatgttgtggctgtggca
gatattcttgacctgaactaa

DBGET integrated database retrieval system