KEGG   Rothia dentocariosa: HMPREF0733_11821Help
Entry
HMPREF0733_11821  CDS       T01343                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rdn  Rothia dentocariosa
Pathway
rdn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rdn01100  Metabolic pathways
rdn01110  Biosynthesis of secondary metabolites
rdn01130  Biosynthesis of antibiotics
rdn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0733_11821 (trpC)
Enzymes [BR:rdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF0733_11821 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NanE DNase-RNase QRPTase_C DUF4042 TruD
Motif
Other DBs
NCBI-ProteinID: ADP41278
UniProt: E3H1Q5
Position
2017616..2018410
Genome map
AA seq 264 aa AA seqDB search
MSTVLDEIIGGVREDLEDRRAKHPLEKVQELALSTAPALDAVCALRGDGQTVRIISEVKR
SSPSKGVLGEIADPAELAVKYQRGGAAAISVLTEERRFGGSLEDLDAVRAHVSIPILRKD
FIVDEYQIWEARAHGADLVLLIVAALEEDTLSAFLELAESLGMNALVEAHTSEEISIAQR
VGAKIIGINVRNLKTLEVKNAHYAELAADLPESVIKVAESGVSELSDVQNYAQAGADVVL
IGETLVKSGDPEKTVREFSAVPHL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaccgtactagatgaaattattggtggagtacgtgaggatttagaggatcgtcgt
gcaaaacatcctctggaaaaggtgcaggagctagcgctctctacggcaccagctcttgac
gctgtatgtgctttacgtggtgatggccaaactgtgcgcatcatttcagaggtgaaacgt
tcgtctccttcgaaaggtgtcctgggggaaatagcggatccagcggaactagcagtgaag
tatcagcgtggaggagcagcagctatttcggtgcttactgaagaacgccgtttcggcgga
agcctggaggatctggacgcggtgcgtgctcacgtcagtattcccatattgcgtaaagat
tttattgttgatgagtaccagatttgggaagcacgtgcacacggcgcagatctggtgctt
cttattgttgctgccttggaagaagataccttgagcgctttcttagagcttgccgaatcg
cttggtatgaatgctctcgtagaagcacatacttcagaagaaatatctatcgctcagcgt
gtcggagccaaaattataggtattaacgttcgcaacctaaaaactcttgaagtcaagaac
gcgcattatgcagagcttgcggccgatctgccggaaagcgttattaaagttgcagaatct
ggtgtatctgagctgagcgatgtacagaactacgcgcaggctggtgctgatgtcgtgctt
attggtgagactctggtcaaatctggagacccggagaaaactgtacgtgaattttcggct
gtacctcatctctaa

DBGET integrated database retrieval system