KEGG   Rothia dentocariosa: HMPREF0733_11822Help
Entry
HMPREF0733_11822  CDS       T01343                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rdn  Rothia dentocariosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0733_11822 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0733_11822 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0733_11822 (trpB)
Enzymes [BR:rdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0733_11822 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2018598..2019929
Genome map
AA seq 443 aa AA seqDB search
MSENLADAFLEGKSLKNAPGPYFGQYGGRWMPESLIAAMDELESTFQNAKQDPEFIAEFQ
RLSAEYSNRPSLLTEVPRFSEHAGARIFLKREDLNHTGSHKINNVLGQALLAKRMGKTRL
IAETGAGQHGVATATAAALFGMDCVIYMGEEDTERQALNVARMQLLGAKVIAVQNGSRTL
KDAINEALRDWVANVENTHYLLGTAAGAHPFPTMVRFFHDAIGSEAREQIQQMTGRLPHG
VSACVGGGSNAIGIFHAFLDDHDVKLYGFEAGGDGVETGRHAATINLGRPGMLHGAVTYL
MQDEDGQTIESHSISAGLDYPGVGPEHSYLSDLGRVSYQPVTDTEAMDAFQLLCRTEGII
PAIESAHALAGALRVCQEWAHQDSESAREKIMVVCLSGRGDKDMETALKWFDLGKATPSS
SLMTGNKEAVAEKAVQAESEAHA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacctggcagacgcatttcttgaggggaaatccctcaaaaatgcacccggt
ccctacttcgggcaatacggtgggcgatggatgcctgaatcgttaattgccgccatggat
gagcttgagtctaccttccagaatgctaagcaggatccagagtttattgcggaatttcag
cgactctctgctgaatactcgaatcgtccttcattgctaacggaagttccgcggttctca
gagcacgctggggctcggatctttctgaaacgtgaagatcttaaccataccggtagccac
aagattaacaatgttttaggacaagcacttctcgcaaagcgcatgggtaagacacgtctg
atcgcggagaccggtgctggtcagcacggcgtagcaacggcaacggctgctgcgcttttc
ggcatggactgtgtgatttacatgggtgaagaagatactgagcggcaggctttgaacgtg
gcgcgtatgcagcttttgggcgcgaaagttattgccgttcagaatggctcccgtactctg
aaagacgctattaatgaggctcttcgagactgggtcgctaatgtcgagaatacccactat
ctgctgggtacagcggcgggagcacatccttttcctacaatggtgcgtttctttcatgat
gctattggttctgaagcacgcgaacaaattcaacagatgactgggcgtcttccccacgga
gtttctgcctgtgttggtgggggttcaaacgccattggaatcttccatgcattccttgat
gaccacgatgtaaaactttacggttttgaggcggggggagacggtgtagaaaccggacgt
cacgccgcaactattaatctaggccgcccaggaatgcttcacggtgccgtaacctacctg
atgcaagacgaagatgggcaaactatagagtcgcattcgatttctgctggcctggactat
cccggcgttggacccgaacactcatacctttcagacttaggccgtgtcagctaccagccg
gtgaccgatactgaagctatggatgcttttcaactgctttgccgtactgaaggtattatt
cctgccatcgaatcggcgcatgcacttgccggtgcgttacgggtctgtcaggagtgggcg
catcaagattctgagtctgcccgtgaaaaaataatggtggtgtgcctatctggtcgtggc
gataaagacatggagactgccttgaaatggttcgatctagggaaagcaaccccgtcatct
tctctcatgacaggcaataaagaggcagttgctgagaaggcagtgcaggcagaaagcgag
gcgcacgcatga

DBGET integrated database retrieval system