KEGG   Rothia dentocariosa: HMPREF0733_11823Help
Entry
HMPREF0733_11823  CDS       T01343                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rdn  Rothia dentocariosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0733_11823 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0733_11823 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0733_11823 (trpA)
Enzymes [BR:rdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0733_11823 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2019926..2020777
Genome map
AA seq 283 aa AA seqDB search
MSYQDAQRHAAKYEVLDGTFPPQNPNSLLVQRLRECKEDGRAALIGYLPAGFPNFEDSVA
AAIELGNNGADIIELGVPYSDPVMDGPVIQHATGAALEGGFKLSRVFDAVRRITEATQAV
VVVMTYWNPVLAYGVDNFARDLAAAGGAGMITPDLVPDEASAWFEASEKYGLDRIFLAAL
SSSPQRLGTIAKASSGFVYAVSVMGVTGARTSVSEAAQGLVENLHAAGAEYACVGLGVST
RAHVEEIGTYADGVIVGTALVKALADGGPIAVGALTRELAGRA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaagacgcacagcggcatgcggcaaagtacgaagtccttgacggtaccttc
ccgccccaaaacccgaactcgcttctcgtgcagcggttacgcgaatgcaaagaagatggg
cgtgcagcacttatcgggtacctccccgcaggttttcccaactttgaagattctgtggca
gcagctatcgaattaggcaataacggtgccgacattattgagctgggcgtaccgtactcg
gatccggtcatggacggccccgttatccagcacgcaacaggtgccgcgttagaaggcggc
ttcaaactttctcgggtttttgatgctgtacggcgcattactgaggcaacccaagctgtc
gttgtcgtgatgacgtattggaaccccgtacttgcctacggtgttgataattttgcacgt
gatcttgcggctgctggaggagctggaatgatcactccagatttagtacccgatgaagca
tcggcttggttcgaagcctctgaaaaatacgggttagatcgtattttcttggcggcgcta
tcatcatcgcctcaacgtttagggactatcgctaaggcttcgagcgggttcgtttatgcc
gtttctgtcatgggcgttacaggggctcgcacctcagtctcagaagctgcccaaggactt
gtcgaaaaccttcatgctgcaggcgctgaatacgcgtgtgttggtttaggcgtttcaact
cgtgcccatgttgaagagatcggaacttatgcagatggtgtgattgtaggaacggcactt
gtaaaagctctagctgatggaggtcctattgcggtgggagcattaactcgtgaacttgca
ggacgtgcatag

DBGET integrated database retrieval system