KEGG   Rothia dentocariosa: HMPREF0733_11873Help
Entry
HMPREF0733_11873  CDS       T01343                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rdn  Rothia dentocariosa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0733_11873 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF0733_11873 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0733_11873 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0733_11873 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0733_11873 (tpiA)
Enzymes [BR:rdn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0733_11873 (tpiA)
Exosome [BR:rdn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0733_11873 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0733_11873 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0733_11873 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2084119..2084895
Genome map
AA seq 258 aa AA seqDB search
MSRKPLIAGNWKMNLNHAEAVTLVQKLAWTLDDSNFDFTKTEVAVFPPFTDIRSVQTLIE
GDKLSIEYGGQDLSVHESGAYTGEISGAFLQKLGAKYVLVGHSERRTYHHESDELCAAKV
QAAYTYDLTPVLCVGEALEVREAGTHVDFTLEQLRGSIAGLSAKQAETLVVAYEPVWAIG
TGKVATADDAQEMSAAIRAEFEKLYSADVAQKVRILYGGSVKSSSAPSIMGKEDVDGVLV
GGASLQAEEFAAIARFDA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaaaccgctgatcgccggtaactggaagatgaatcttaaccatgctgaagcc
gttacgttggttcagaagctagcatggactcttgatgattcgaattttgattttacaaag
actgaagtagcggtattccctccctttaccgatattcgctccgtacaaaccctcattgaa
ggtgacaaactgagtattgagtatggcggtcaggatctttctgtacatgaatccggtgcg
tataccggagagatctctggtgcttttttgcaaaaacttggtgcgaaatacgttctcgta
ggacactctgagcgtcgcacttaccatcacgaaagtgatgaactatgcgctgctaaggta
caggctgcttacacctatgatttgactccggtactgtgcgttggtgaagctctggaagtt
cgtgaggctggcactcatgtggactttacccttgagcagcttcgcggttctattgcaggc
ttgagcgccaagcaagcagaaactctcgtggttgcgtatgaacctgtatgggcaattggc
actggtaaggtcgcaactgctgatgatgcgcaggaaatgtctgcggctatacgtgctgaa
tttgaaaagctctactccgcagacgttgctcagaaggttcgtattctctacggtggatcg
gttaagtcttcttctgcaccctctattatggggaaagaagacgtggatggtgtgctggta
ggcggcgcatcccttcaggctgaagagtttgcagcaattgcgcgttttgatgcatag

DBGET integrated database retrieval system