KEGG   Rothia dentocariosa: HMPREF0733_12020Help
Entry
HMPREF0733_12020  CDS       T01343                                 

Gene name
ruvA
Definition
crossover junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rdn  Rothia dentocariosa
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rdn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2259878..2260498)
Genome map
AA seq 206 aa AA seqDB search
MIASLTGHVTHVGLESAILDVNGFGMLVRATARTLSNLRTGSTATLLTSMIVREDSMTLY
GFAEPAEREVFEMMLSVSGIGPRIALAVLSVHTATEVERAVATGDDKAFTKVPGIGPKSA
RRIVLELAGKLILSKDQAEENAPAQGIAWKPQVMDALTSLGWSEKDADAAIDAYVQHNPD
AEKEAVSAALRGVLASLGAQNTVGRH
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtcgttaacggggcatgtaacccatgtagggctagagagcgcaattcttgat
gtcaatgggtttggtatgctcgttcgggccacagcacgcaccctctcaaatctgcgcacg
ggatccactgcaaccttgttgacctctatgatcgtgcgcgaagactccatgactctctat
gggtttgcagaacctgcagagcgagaggtctttgaaatgatgctctcggtttcggggatt
ggcccgcgtatcgcccttgccgtcttgagcgtgcatactgccaccgaggttgagcgagcc
gttgcaaccggcgatgataaagcctttaccaaagttccggggatcgggccgaaaagtgcg
cggcgcattgtgctagaactggctggtaaactcattttgagtaaagatcaggccgaagaa
aacgctcccgcccaaggcatcgcatggaagccccaggttatggatgcgctcacctcttta
gggtggagcgaaaaagacgcagatgccgcaatcgacgcttacgtgcagcataacccagat
gcagaaaaggaagccgttagtgctgccctgcgaggggtacttgcctctctgggggcacag
aatacggtggggcggcattag

DBGET integrated database retrieval system