KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000022Help
Entry
RHECIAT_CH0000022 CDS       T00720                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHECIAT_CH0000022 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_CH0000022 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHECIAT_CH0000022 (trpB)
Enzymes [BR:rec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHECIAT_CH0000022 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17502..18722
Genome map
AA seq 406 aa AA seqDB search
MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNKAKTDPAFQAELQHLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGAEAKEQMLAAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDPSVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLSDIGRVDYVPIMDHEALEAFQTLTRLEGIIPA
LEAAHAIAEVIKRAPTMSKDEIILMNLSGRGDKDIFTVGKILGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaacgcctaaaccgaattccttccgttccgggcctgacgaagacggccgcttc
ggcatttacggcggtcgtttcgttgccgaaacattgatgccgctgatcctcgatctgcag
gacgagtggaacaaggctaagaccgatccggcctttcaggcggagctgcagcatctgggc
gcgcactacatcggccgccccagcccgctctatttcgccgagcggctgacggccgaactc
ggcggcgcgaagatttacttcaaacgcgaggagctgaaccacaccggttcgcacaagatc
aacaactgcatcggccagatcctgctcgccaagcgcatgggcaagacccgcatcatcgcc
gaaacaggcgccggccagcacggcgtcgcctcggccaccgttgccgcccgcttcggactt
ccctgcgtcgtctacatgggcgcaaccgacgtcgagcgtcaggcgccgaacgttttccgc
atgaagctgcttggagcggaagtcaaaccggtgacggcaggcagcggcacgctgaaggac
gccatgaacgaggcgctgcgcgactgggtcaccaatgtcgaggacacctattacctcatc
ggcacggcggccggcccgcatccctatccggagatggtccgcgatttccagtcggtaatc
ggcgcggaggcgaaagagcagatgctggcggccgaaggccgtctgccggatctcgttgtc
gctgccgtcggcggcggctcgaatgcgatcggcatcttccaccccttcctcgacgatccc
tcggtgaagatcgtcggcgtcgaagccggcggcaagggcctgcagggcgacgaacattgc
gcctcgatcaccgccggttcgccgggcgtgctgcacggcaaccgcacctatctgctgcag
gatggtgacggccagatcaaggaaggccattcgatttcggccggtctcgattatcccggc
atcggccccgaacactcctggctcagcgatatcggccgggtcgattacgtgccgatcatg
gaccacgaagcgctcgaagccttccagacgctgacccgcctcgaaggcatcatcccggcg
ctggaggcagcgcatgcgattgccgaggtcatcaagcgtgcgccgacgatgagcaaggac
gagatcatcctgatgaacctctccggccgtggcgacaaggacatcttcaccgtcggcaag
attctgggaatgggactgtaa

DBGET integrated database retrieval system