KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000023Help
Entry
RHECIAT_CH0000023 CDS       T00720                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHECIAT_CH0000023 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_CH0000023 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RHECIAT_CH0000023 (trpA)
Enzymes [BR:rec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RHECIAT_CH0000023 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18726..19565
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTDDATPIVMMGYYNPIYIYGVEKFLDDAL
TAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPAVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVQRIKQHTELPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTKDGKATADTVQAVATLVRGLSSGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgaaggccgtccggcgctc
gtgacctatttcatgggcggcgatcctgattacgacacctctctcggcatcatgaaggcg
ctgccggaggcagggtccgacatcatcgaactcggcatgcccttttccgatccgatggcc
gacggtccggcgatccaactggccggtcagcgtgcgctgaagggtggccagacgctgaag
aagacgctgcagctggccgccgacttccgcaaaaccgacgatgcgacgccgatcgtgatg
atgggctattacaatccgatctacatctacggcgtcgaaaaattcctcgatgacgcgctg
accgccggtatcgacgggctgatcgtcgtcgacctgccgcccgagatggatgacgagctc
tgcattccggcgatccgcaaggggatcaacttcatccgcctggcaacgccgaccaccgat
gagaagcgcctgcccgccgtgctgaaaaacacctccggcttcgtctactacgtctcgatg
aacggcattaccggctcggcgctgcccgatccgtcgctggtttcgggcgccgtccaacgc
atcaagcagcataccgagctgcccgtctgcgtcggcttcggcgtcaagacggcggaacat
gccaaggtcatcggcggctcggccgacggcgtcgtcgtcggcaccgccatcgtcaatcag
gtcgccaccagcctgaccaaggacggcaaggcgaccgccgacacggttcaggcggtcgca
acgctggtgcgcggcctctcatcgggaacccgttcggcgcgccttgttgctgccgaatag

DBGET integrated database retrieval system