KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000055Help
Entry
RHECIAT_CH0000055 CDS       T00720                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0000055 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHECIAT_CH0000055 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RHECIAT_CH0000055 (glcB)
Enzymes [BR:rec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RHECIAT_CH0000055 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53097..55268
Genome map
AA seq 723 aa AA seqDB search
MSRIDKNGLAVEAVLHDFLVQEVLPGLAIDADKFFADFSAIVHDLAPINRALLKKRDELQ
LKIDDWYRQHGAPTDMDDYQSFLRAIGYLLPEGSDFQVSTQNVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPEGDGAEKGRGYNPKRGEKVIAWVRDFLDTSVPL
QDSRWKDVGSFAVRDGALIIRSTDGEQAMLRDGGHFAGYRGDAATPTHILLKNNGIHIEI
VIDAATAIGKTDPAHISDVWLESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLQE
EVAKGGASFIRKLNPDLDYTGPDGTTFELHRRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAVITGLIALYDIGPAGRKKNSRTGSMYVVKPKMHGPEEVAFAVEVFSRVEDALGLAR
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAKVQQGLKDRARAKLSDILSVPVAVRPNWSQEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNIGLMEDRATLRISAQHMANWLHHKVVSEAQIVETMKR
MAAVVDRQNEQDPVYQPISGNFDGSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QAA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgataagaacggtcttgccgtcgaagccgtccttcatgatttcctcgtg
caggaagttctgccgggtctggcgatcgatgcggacaagttctttgccgatttttcggcg
atcgtccatgatctcgcccccatcaatcgggcgttgttgaagaagcgcgacgagttgcag
ctcaagatcgatgactggtatcgccagcacggcgctccgaccgatatggatgactaccag
tcgttcctgcgcgcaatcggctatctcctgccggaggggtcggacttccaggtttcgacc
cagaatgtcgatcccgagatcgcctcgatcgccggtccgcagctcgtcgttcccgtcatg
aacgcgcgttatgccctcaacgccgccaatgcccgctggggttcgctctatgatgcgctc
tacggcacggacgccattcccgagggcgacggcgccgaaaaaggcaggggatacaacccg
aagcgcggcgagaaggtcatcgcctgggtgcgcgatttcctcgatacatcggtgccgctg
caggacagccgttggaaggatgtgggaagcttcgcggtcagggatggggcgctcatcatc
cggtcgaccgatggcgagcaggcaatgctgcgggatggcggccattttgccggctatcgc
ggcgatgccgccactccgacgcatattctcctgaagaacaacggcatccatatcgagatc
gttatcgatgcggcaacggcgatcggcaagaccgatccggcccatatttccgatgtctgg
ctggaatcggcgatcaccaccatcatggattgcgaggattcgattgccgccgtcgacgcc
gaggacaaggtcgtcgtctaccgcaactggctaggcctgatgaagggtgatctgcaggag
gaggtggcaaagggcggcgcgagcttcatccgcaagctcaacccggacctggactacacc
ggtcccgatgggactaccttcgagctgcatcgccgctcactgatgctggtgcgcaacgtc
ggccacctcatgaccaatcctgccattctcgaccgcgatggcaacgaagtgcccgagggc
atcatggatgccgtcatcaccggcctgatcgcgctttacgatatcggcccggccggccga
aagaagaattcccgcaccggctccatgtatgtggtcaagccgaaaatgcatggcccggag
gaagtcgccttcgccgttgaggtcttctcgcgggtcgaagatgcgcttgggctggcgcgc
aacaccatcaagatgggcatcatggacgaggagcgccgtaccacggtcaatctcaaggaa
tgcatccgcgccgcccgcgaacgtgtcgtcttcatcaataccggcttcctcgatcgcacc
ggtgatgagattcatacctcgatggaagccgggccgatgattcgcaagggcgacatgcgc
caggccgcctggatatcggcctatgagaactggaatgtggacatcggcctcgaatgcggc
ctcgccggtcatgcccagatcggcaaggggatgtgggcgatgccggatctgatggcggcg
atgctggagcagaagatcgcccatcccaaagctggcgccaacaccgcctgggttccgtcg
ccgacggccgcgaccctgcatgccacccactatcaccgcgtcaatgtcgccaaggttcag
cagggactgaaggaccgcgcccgcgccaaactgtccgacattctctcggtgccggtcgcg
gtgcggccgaactggtctcaggaggaaatccagcgcgaactcgacaacaatgcccagggc
atcctcggctacgtcgtgcgctgggtcgatcagggcgtcggctgctcgaaggtgcccgac
atcaacaatatcggcctgatggaggatcgcgcgacattgcgcatttcggcccagcacatg
gcaaactggctgcatcacaaggtggtcagcgaagctcagatcgtcgaaacgatgaagcgc
atggcggccgtcgtcgaccggcagaacgagcaggacccggtctatcagccgatatcaggt
aatttcgatgggtcgatcgccttccaggccgcccttgatctggtgttgaagggtagggag
cagccgaacggctataccgagccggtgcttcaccgccgccgcctcgagctgaaggcgaag
caggccgcttga

DBGET integrated database retrieval system