KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000171Help
Entry
RHECIAT_CH0000171 CDS       T00720                                 

Gene name
cycM
Definition
cytochrome c protein
Orthology
K08738  
cytochrome c
Organism
rec  Rhizobium etli CIAT 652
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RHECIAT_CH0000171 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHECIAT_CH0000171 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
184604..185170
Genome map
AA seq 188 aa AA seqDB search
MNSYVNTAVGALLGTIFVLMSVSIASEGIFHSEAPEKEGFAIVAEEAPAAGGEAAPAAAA
VPIAQLLASADAKAGEAVFKKCQACHDGTKGGPNKVGPNLFGVVDRPIASHEGFAYSSAM
KDFSKGSSEKWTFEALNKFLTAPKKDVPGTAMGFAGLAKDQDRANVILYLHTLADSPVPL
PDPKTATQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatacgtcaatacggccgtgggggcgctgctcggaacgattttcgttctgatg
tcggtctccatcgcgtccgaggggatcttccattccgaagcgccggaaaaggaaggtttc
gcgatcgttgccgaagaggcgcccgccgccggcggtgaagccgcgcctgccgctgctgcc
gttccgatcgcgcaattgctcgcctctgcagatgccaaggccggtgaagcggtcttcaag
aagtgtcaggcctgtcatgacggcaccaaagggggaccgaacaaggtcggtcctaacctc
tttggtgtcgtagatcgcccgatcgcctcgcatgaaggctttgcctattcctctgcgatg
aaggatttttccaagggcagttctgaaaaatggaccttcgaggccctcaacaagttcctg
acggcgccgaagaaggacgttcccggcaccgcaatgggctttgcaggtctggcgaaggat
caggaccgcgccaacgtcatcctctatctgcacacgctcgccgattcgccggtgccgctg
ccggatccgaaaaccgcaacgcagtaa

DBGET integrated database retrieval system