KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000216Help
Entry
RHECIAT_CH0000216 CDS       T00720                                 

Gene name
glk
Definition
(GenBank) glucokinase protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00010  Glycolysis / Gluconeogenesis
rec00052  Galactose metabolism
rec00500  Starch and sucrose metabolism
rec00520  Amino sugar and nucleotide sugar metabolism
rec00521  Streptomycin biosynthesis
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01200  Carbon metabolism
Module
rec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0000216 (glk)
   00052 Galactose metabolism
    RHECIAT_CH0000216 (glk)
   00500 Starch and sucrose metabolism
    RHECIAT_CH0000216 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RHECIAT_CH0000216 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHECIAT_CH0000216 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RHECIAT_CH0000216 (glk)
Enzymes [BR:rec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RHECIAT_CH0000216 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACE89212
UniProt: B3PXK6
Position
complement(234296..235321)
Genome map
AA seq 341 aa AA seqDB search
MPKPNHSTAPLPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQKGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLGIEDVLVVNDFEAQALAVA
ALSDENRERIGDATGDMIASRVVLGPGTGLGVGGLVHAQHSWIPVPGEGGHVDLGPRSKR
DYQLFPHIETIESRVSAEQILCGRGLVNLYNAICIVDGIQPTMKDPADITSHALAGSDKA
AVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKILPALKKPEFRMAFEDKAPHTA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaccgaaccacagcaccgctccgctgcccttcccgatcctgatcggcgatatc
ggcggcaccaatgcccgtttctccatcctgaccgatgcctatgccgaaccgaagcagttt
ccgaacgtgcgcacggcggatttcgcaacgatcgacgaagcgatccagaagggcgtgctc
gacaagaccgcggtgcagccgcgctcggcaattctcgccgtcgccggcccgatcaacgac
gacgagatcccgctgaccaattgcgactgggtggtgcggcctaagacgatgatcgagggc
ctcggcatcgaggacgtgctcgtcgtcaacgatttcgaggcgcaggcgctggccgtcgcc
gcgctttcggatgagaaccgcgaacgcatcggcgacgccaccggcgatatgatcgcctcg
cgcgtcgtgctgggacccggcaccggcctcggcgtcggcggcctcgttcatgcccagcac
agctggatcccggtccccggcgaaggcggccatgtcgatctcgggccgcgcagcaaacgc
gactatcaactcttcccccatatcgagacgatcgagagccgcgtttcggccgagcagatc
ctctgcgggcgcggcctcgtcaacctctataacgccatctgtatcgtcgacggcatccag
ccgacgatgaaggatccggccgacatcacctcgcacgcgcttgccggcagcgacaaggcc
gccgtcgagaccgtgtcgctgtttgccacctatctcggccgggtggcgggcgacatggcg
atggtgttcatggcgcgcggcggcgtctatctctccggcggcatctcgcagaagatcctc
ccggccctgaagaagccggaattccgcatggctttcgaggacaaggcgccgcacaccgcc
ctgcttcgcactatcccgacctatgtggtgacgcacccgctggcggcccttgccgggctt
tcctcctatgcgcgcatgccggcgaatttcggcgtgtcgacggaaggccgccgctggcgg
cgctga

DBGET integrated database retrieval system