KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000239Help
Entry
RHECIAT_CH0000239 CDS       T00720                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rec00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255535..256842
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRRKRDGGELAAADIRSFIDALAAGRLSEGQIGAFAMAVWFKGMSRQEIVALTL
AMADSGDRLQWADIDRPIADKHSTGGVGDNVSLMLAPIAAACGLAVPMISGRGLGHTGGT
LDKLESIPGYMITPDADLFHRVVKQAGCAIIGQTGALAPADGRLYAVRDVTATVDSIPLI
TASILSKKLAAGLQTLVLDVKVGNGAFMAERDQAEMLARSLVEVANGAGVKTSALITDMN
EPLADSAGNVVEMRNCLDFLAGRKGNTRLEAVVLAFAAEMLEKSGIAALPEEGEAMARRA
LSSGKAAEIFSRMVSMLGGPADLIENPDRYLARAPVEKPVAAARSGWLAACDARGIGVSV
IDLGGGRRHPADRIDHRVGFSELLPLGTRVNAGEPIALVHAADDAAAERAAAALAAHYRI
TEDAPALNPIISGLI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcaggagatcatccggcgcaagcgcgacggcggtgaactcgccgccgccgat
atccggtctttcatcgatgcgcttgccgctggtcgattgtccgaaggccagatcggcgcc
ttcgccatggccgtctggttcaagggcatgtcgcgccaggaaatcgtcgccttgacgctg
gcgatggccgattccggcgaccggctgcaatgggccgatatcgaccgtccgattgccgac
aaacattcgactggaggcgtcggcgacaatgtctcgctgatgctggcgccgatcgccgcc
gcctgcggcctcgccgtcccgatgatatcaggccgcggcctcggccataccggcggcacg
ctcgataagcttgaatccattcccggctatatgatcaccccggatgcggatctgtttcac
cgggtggtcaagcaggcaggatgcgccatcatcggccagaccggcgctttggcgcccgct
gacggcaggctctacgccgtgcgcgatgtaaccgccaccgtcgattccattcccttgatc
accgcctccatcctctccaagaagcttgccgccggtcttcagacgctggtgctcgacgtc
aaggtcggcaacggcgccttcatggctgagcgcgatcaggcggaaatgctggcacggtcg
ctggtcgaggtggcgaatggcgcgggcgtgaagacgtcggcgctcatcaccgacatgaac
gagccgctcgccgatagcgccggcaacgtcgtggagatgcgcaactgcctggatttcctg
gcgggcaggaaaggaaatacgcggctcgaggctgtcgttcttgccttcgccgccgagatg
ctggagaaatcgggcattgccgctttgcctgaggaaggcgaggcaatggcgcgccgggcc
ctgtcgtcggggaaggcggccgagattttctcgcgcatggtatccatgctcggcggcccg
gccgatctgatcgagaacccggacagatacctcgctagagcgccggtcgaaaagcctgtt
gcggccgcgcggtccggctggcttgccgcctgcgacgcccgtggcatcggtgtcagcgtc
atcgatcttggcggcggacggcgccatcccgccgatcggatcgatcaccgcgtcggcttc
tccgaactgctgccgcttggcacccgcgtgaatgccggcgagccgatcgccctcgttcac
gccgccgacgacgccgcggcggaaagggcggccgcagcacttgccgcgcactaccgcatc
accgaggacgcgccggcgctgaacccgatcatttcaggccttatctga

DBGET integrated database retrieval system