KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000271Help
Entry
RHECIAT_CH0000271 CDS       T00720                                 

Definition
carboxymethyl cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHECIAT_CH0000271
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RHECIAT_CH0000271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(289694..290743)
Genome map
AA seq 349 aa AA seqDB search
MRTTRHLTAPLLAAALIASPALGADKPCYRGVNLSGGEYGERDATYGTNYLYPSEATIGY
FAKKGMTIIRLPFRWERLQAALGGRFDAEELTRIKETVALIRKHGMAVLLDPHNFGYYDK
IQIGTAPATDAAFADFWARLAVEFANEDGVLFGLMNEPHDIKATDWLDAANAAIRSIRAI
GARNLILVPGTAWSGAHSWEKDVIGGANGTVMLGVRDPLDFYAYEVHQYLDIDSSGTHPT
CEGATAAVEAIAGVTAWLKQNHKRGFLGEFGASADKDCMGGLKEIYATMSGNSDVWLGWS
YWAAGEWWPADEPFNVQPHQGPERPQMRLLAESAKADRGACTTVKPAGN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgacacgacatctgacggcgccgctgcttgcggccgccctcatcgcgtcgccg
gcgcttggcgccgataagccctgctatcgtggcgtcaatctgtccggcggcgaatatggc
gagcgcgacgcgacctacggtacgaactatctctatccgagcgaggcaacgatcggctat
ttcgccaaaaagggcatgaccatcatccggctgcccttccgctgggagcggctgcaggcg
gcgctcggcggccggttcgacgcggaagaactcacgcggatcaaagagaccgttgctctg
atccgcaagcacggtatggccgtcctgctcgatccgcataatttcggctattacgacaag
atacagatcggcaccgcgccggcgaccgacgccgccttcgccgatttctgggcgaggctt
gccgtcgaattcgccaatgaggacggcgtgctcttcggcctgatgaatgaaccgcatgac
atcaaggcgacggactggctcgatgccgccaacgctgcgatccgcagcatccgggccatc
ggcgcacgcaatctcatcctcgtgccgggcaccgcctggagcggtgctcacagctgggaa
aaagacgtaatcggcggcgccaacggcacggtgatgctcggcgtgcgcgacccgctcgac
ttctacgcttacgaggtccaccaatatctcgacatcgactcgtcgggaacccatccgacc
tgcgaaggtgcgaccgccgctgtcgaggcgatcgccggcgtcaccgcctggctgaagcag
aaccacaagcgcggctttctcggcgaattcggcgcctccgccgacaaggactgcatgggc
ggtctgaaagagatctacgccaccatgtcaggaaatagcgacgtctggcttggctggtcc
tattgggcggcgggcgaatggtggccggcggacgagcctttcaacgttcagccgcatcag
ggccccgagcggccgcagatgcggcttctcgccgagtcggccaaggccgatcgcggcgcc
tgcaccaccgtcaagcccgcggggaactga

DBGET integrated database retrieval system