KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000393Help
Entry
RHECIAT_CH0000393 CDS       T00720                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rec03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403064..403954
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVKRGLAPAMEGARVARLELRRQDLRFPFPEALADRVSGRTIVGLGRRAKYL
LVDLDDGNTLVSHLGMSGSFRIEEGAASAMPGEFHHARTKDEKHDHVVFHLEGQGGPRRV
VYNDPRRFGFMDMVRRADLAAHPFFRDLGPEPTGNDLGAAYLAERFRDKAQPLKSALLDQ
KNIAGLGNIYVCEALWRSHLSPIRAAGTLVTPGGKPKEKLGLLVASIRDVIADAIAAGGS
SLRDHIQTDGSLGYFQHSFSVYDREGQACGTPGCGGTVARIVQAGRSTFYCAACQK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccagaagtcgaaacggtcaagcgcgggctggcgccggcgatggaaggg
gctcgcgtcgcgcggctggaactgcgccgccaggaccttcgcttcccctttcccgaagcc
ttggcggacagggtttccggccgcaccatcgtcgggcttggccgccgcgccaaatatttg
ctggtcgatctcgacgacggcaatacgctggtttcccatctcggcatgtccggttccttc
cgtatcgaggagggcgcggcctcggcgatgccgggcgaattccatcacgcccgcaccaag
gacgagaagcacgatcacgtcgtctttcatctcgaaggccaggggggcccgcgccgcgtc
gtttataacgacccgcgccgtttcggcttcatggatatggtcagacgagccgatcttgcc
gcccatcccttcttccgtgacctcggcccggagccgacgggcaacgatctcggcgccgcc
tacctcgccgaacgtttccgcgacaaggcgcagcctttgaagagcgcgcttctcgaccag
aagaacattgccggtctcggcaatatatatgtctgcgaggcgctgtggcgttcgcatctt
tcgccgatccgcgccgccggcaccctggtgacgccgggcggcaagccgaaggaaaagctc
ggcctgctcgtcgcctcgatccgcgacgtcatcgccgatgcgatcgccgccggcggatcg
tcgttgcgcgaccatatccagaccgacgggtcgctcggctatttccagcattccttctcc
gtctatgatcgcgaaggtcaggcttgcggcacgcccggctgcggcggtacggtcgcccgt
atcgtgcaggcgggccgctccaccttctattgcgccgcctgccagaaataa

DBGET integrated database retrieval system