KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000394Help
Entry
RHECIAT_CH0000394 CDS       T00720                                 

Gene name
fadB1
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RHECIAT_CH0000394 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHECIAT_CH0000394 (fadB1)
   00650 Butanoate metabolism
    RHECIAT_CH0000394 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_CH0000394 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHECIAT_CH0000394 (fadB1)
   00310 Lysine degradation
    RHECIAT_CH0000394 (fadB1)
   00360 Phenylalanine metabolism
    RHECIAT_CH0000394 (fadB1)
   00380 Tryptophan metabolism
    RHECIAT_CH0000394 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHECIAT_CH0000394 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHECIAT_CH0000394 (fadB1)
   00281 Geraniol degradation
    RHECIAT_CH0000394 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHECIAT_CH0000394 (fadB1)
   00627 Aminobenzoate degradation
    RHECIAT_CH0000394 (fadB1)
   00930 Caprolactam degradation
    RHECIAT_CH0000394 (fadB1)
Enzymes [BR:rec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHECIAT_CH0000394 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403974..404747
Genome map
AA seq 257 aa AA seqDB search
MAYETLIVETRGNVGLVTLNRPQALNALNSTVLKELKVAYAAFHDDEAIGAIVITGSERA
FAAGADIKEMQSLQFADMYKSDFISGWDDIAKARKPVIAAVSGFALGGGCELAMMCDFII
AAETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERSGLVSRVV
APERLLDEALAAAEKIASLSQPSVMMAKEAVNRAFETTLEEGLRFERRLFHSLFATDDQK
EGMAAFVEKRKPAFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaccctgatcgtcgaaacccgaggcaatgtcggcctcgtcacgctgaac
cgcccgcaggcgctgaacgcattgaattccaccgtgctgaaggagttgaaggtggcctac
gccgccttccatgacgacgaggcgatcggcgcgatcgtcatcaccggctccgaacgcgcc
tttgccgccggcgccgatatcaaggagatgcagtcgctccagttcgccgacatgtataag
agtgacttcatcagcggctgggacgacattgccaaggcgcgcaagccggtcattgccgcc
gtcagcggttttgcgctcggcggcggctgcgagctggccatgatgtgcgatttcatcatc
gccgcggagacggcgaagttcggccagccggaaatcaccctcggcgtcattcccggcatg
ggcggttcgcagcggctgacacgcgccgtcggcaaggcgaaggcgatggatcttgtcctg
accggccggatgatggatgcggcagaagccgaacgatcgggactcgtttcgcgtgtggtg
gcgcccgagcgtctgctcgacgaggcgcttgccgccgccgagaagatcgcctcgctttcg
cagccctcggtgatgatggccaaggaggcggtcaaccgcgccttcgagacgacgctggag
gaggggctccgcttcgaacgccgcctgttccacagtctctttgccaccgatgatcagaaa
gaaggcatggcggcctttgtcgagaagcgcaaacccgccttcaagcaccgttga

DBGET integrated database retrieval system