KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000451Help
Entry
RHECIAT_CH0000451 CDS       T00720                                 

Gene name
rbsK1
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHECIAT_CH0000451 (rbsK1)
Enzymes [BR:rec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RHECIAT_CH0000451 (rbsK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(461413..462312)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTDRLPKPGETVAGNGFTTAAGGKGANQALAARRAGRYVHMAGAVG
KDGFAADALALLDDAGTDLSLVKHVDGPTGTALILVGGDGENMIAVVPGANGLVTAADAE
TAVGKMSEGDILMLQLEVPVDAVECALSEARVRGVTSILNLAPLTPDAPRLGRLADIVIA
NETEFERLAGQDGMDAEAREAALHRLHQETGQTLIVTLGGDGVTAIRDGVISRAQGLKIE
PVDTVGAGDTFCGYFTASLDEGLDFASALRRAAVAGSLACLKAGAQPSIPLSQDVADRI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagttttcgggtccatcaacatggatctcatcgccacgacggaccgcctgccg
aagcccggcgagacggtggccggcaatggcttcaccacggccgccggcggcaagggcgcc
aatcaggcgctggcagcccgccgcgctggccgctatgtgcatatggccggcgccgtcggc
aaggatggttttgccgccgatgcgctcgccctgctcgatgatgccggaaccgacctctcc
ctcgtcaaacatgtcgacggtcccaccggcacggcgctgatcctggtcggcggcgatggc
gagaacatgatcgccgtggtgcccggcgccaacggcctggtgacggctgccgatgccgag
acggcggtcggcaagatgagtgaaggcgacattctgatgctgcagctcgaagtgcctgtt
gacgccgtcgagtgcgcgctctcggaagcccgcgtcaggggcgtcaccagcatcctcaac
ctggcgccgcttactcccgatgcgccgcgtctcgggcgcctggccgatatcgtcattgcc
aatgagaccgagttcgagcggctcgccggacaggatggcatggacgccgaagcgcgcgag
gcggcccttcaccgcctgcaccaggagaccggccagacgctgatcgtcacgctcggcggc
gatggcgtcaccgccatccgcgacggcgtcatttcccgggcgcaaggcctgaaaatcgaa
cctgtcgatactgtcggtgcgggcgataccttctgcggttactttaccgccagcctcgac
gaaggcctcgattttgcctcggcgctgcgtcgcgcggccgtcgccggctcgctcgcatgc
ctcaaggcgggggcgcagccttcgatcccgttaagccaggacgtcgcggacagaatatag

DBGET integrated database retrieval system