KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000632Help
Entry
RHECIAT_CH0000632 CDS       T00720                                 

Gene name
fadB2
Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0000632 (fadB2)
   01212 Fatty acid metabolism
    RHECIAT_CH0000632 (fadB2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHECIAT_CH0000632 (fadB2)
   00650 Butanoate metabolism
    RHECIAT_CH0000632 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_CH0000632 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    RHECIAT_CH0000632 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHECIAT_CH0000632 (fadB2)
   00310 Lysine degradation
    RHECIAT_CH0000632 (fadB2)
   00380 Tryptophan metabolism
    RHECIAT_CH0000632 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHECIAT_CH0000632 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHECIAT_CH0000632 (fadB2)
   00281 Geraniol degradation
    RHECIAT_CH0000632 (fadB2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RHECIAT_CH0000632 (fadB2)
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RHECIAT_CH0000632 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHECIAT_CH0000632 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RHECIAT_CH0000632 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
627958..630174
Genome map
AA seq 738 aa AA seqDB search
MSTYTNFTLETDADGIALVTWDMPGKSMNVFTSEVMEELNAIIDATTADAGVKGVVFTSG
KSSFSGGADLSMIKSMFSAYQEEKARNPESAVRTLFGLVGRMSGLFRKLETSGKPWVSAI
NGTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLANAQDALQMM
TTGQSLSGSRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAPWDDKGFKLPGGGIWTPA
SAQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTEVLQTREAFS
MIRSLFISMQELGKGARRPAGIPKTELKHVGVVGAGFMGASIAYVTAAAGLPVTLIDRDL
EAAAKGKAVCEGLVKDSVGKGRFTQDEAAALLARITPAADYAGLATADLVIEAVFEDREV
KKSVIAAVEAVLPEGAIFASNTSTLPITGLAENSKRPADFIGIHFFSPVEKMMLTEVILG
KETGDKALAVALDYVAAIKKTPIVVNDTRGFFVNRCVLRYMSESYDMLIEGVPPAMIENA
AKMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKAIDPRHMELISRMVEKEGRFGRKN
SKGFYDYPPKPAKKSLWPELKDFYPQKKADEVDVAVLKQRFLVTIALEAARTVEEGIVTD
PREADVGSILGFGFAPYTGGALSYIDGMGVKAFVELAERLAGAYGDHFKPTPLLKDMAAR
GETFYGRFDPYAKMGAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctacaccaatttcacgctcgaaaccgacgccgacggcatcgctctcgtcacc
tgggatatgcccggcaaatcgatgaacgtcttcacatcagaggtgatggaagagctcaac
gccatcatcgacgccaccaccgcggacgccggcgtcaagggtgtcgtcttcacctcgggc
aaatcctccttctccggcggcgccgatctctcgatgatcaagtcgatgttcagcgcctat
caggaggagaaggccaggaacccggaatcggccgtccggacgctcttcggtctcgtcggc
cgcatgtcaggtttgttccgcaagctcgaaacctcgggcaagccctgggtttccgccatc
aatggcacctgcatgggcggcgctttcgaactgtcgctcgcctgccacggccgcgtcgcc
tccaatgccaagagcgtcaagattgcgctgcccgaggtcaaggtcggcatcttccccggc
gccggcggcacccagcgcgtgccgcggctggccaatgcccaggatgcgctgcagatgatg
acgacaggccagtcgctgagcggctcccgcgccaaggcgatgaacctcgtgcatcaggtg
gtcgagccggaccagctgatccccgccgccaagcagatgatcaaggacggtctgaagccg
gtcgccccttgggacgataaaggcttcaagcttccgggcggcggcatctggacgccggcc
tcggcccagctctggccggccgcgccggcaatcctgcgccgcgaaacctcgggcaattat
ccggcagcgctcgccatcctgaaatgcgtctatgaaggcctgcaggtgccgttcgacacc
ggcctgaagatcgagcagcgttatttcaccgaggtgctgcagacccgcgaagccttctcg
atgatccgttcgctgttcatttccatgcaggagctcggcaagggcgcccgccgcccggcc
ggcattccgaagaccgaactgaaacatgtcggcgtcgtcggcgccggtttcatgggcgcc
tcgatcgcctatgtcaccgccgccgccggtctcccggtgacgctgatcgaccgcgacttg
gaggccgccgccaagggcaaggcggtctgcgaaggcctcgtcaaggattccgtcggtaag
gggcggtttacgcaggacgaggctgcggcccttcttgcccgcatcacgcctgccgccgac
tatgccggtcttgccaccgccgatcttgtcatcgaggcggtgttcgaagatcgcgaagtg
aagaaatcggtcatcgcggcggttgaagccgtgctgccggaaggcgccatcttcgcctcc
aatacctcgaccctgccgatcacgggccttgcggagaattccaagcgcccggccgatttc
atcggcatccacttcttctcgcccgtcgagaagatgatgctgaccgaggtcatcctcggc
aaggagaccggcgacaaggcgctggccgtcgcgctcgattatgtcgcggcgatcaagaag
acgccgatcgtcgtcaacgacacccgcggtttcttcgtcaatcgctgcgtgctgcgctac
atgtctgagagttacgacatgctgatcgagggcgtgccgcccgccatgatcgagaatgcc
gccaagatggccggcatgcctgtcggtcccctggcgctgaacgacgaggtcgccatcgac
ctgtcgctgaagatcctcaaggccaccgtcgccgatctcggcgagaaggcgattgacccc
aggcatatggagctgatctcccgcatggtggaaaaggagggccgcttcggccgcaagaac
tccaagggcttctacgactatccgccgaaaccggcgaagaagtcgctctggccggagctc
aaggacttctatccgcagaagaaggcggatgaggtcgatgtcgccgtcctcaaacagcgc
ttcctcgtcaccatcgcgctggaggccgcccgcaccgtcgaggaaggcatcgtcaccgat
ccgcgcgaagccgacgtcggctcgatcctcggcttcggcttcgcgccctacaccggcggc
gcgctgagctatatcgacggcatgggtgtgaaggctttcgtcgagttggcggagaggtta
gcgggggcttacggggatcacttcaagccgacgccgctgctgaaggacatggccgccagg
ggcgagacgttttatgggcggttcgatccctatgcgaagatgggggcggcggcgtaa

DBGET integrated database retrieval system