KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000644Help
Entry
RHECIAT_CH0000644 CDS       T00720                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RHECIAT_CH0000644
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHECIAT_CH0000644
   00650 Butanoate metabolism
    RHECIAT_CH0000644
  Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_CH0000644
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHECIAT_CH0000644
   00310 Lysine degradation
    RHECIAT_CH0000644
   00360 Phenylalanine metabolism
    RHECIAT_CH0000644
   00380 Tryptophan metabolism
    RHECIAT_CH0000644
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHECIAT_CH0000644
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHECIAT_CH0000644
   00281 Geraniol degradation
    RHECIAT_CH0000644
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHECIAT_CH0000644
   00627 Aminobenzoate degradation
    RHECIAT_CH0000644
   00930 Caprolactam degradation
    RHECIAT_CH0000644
Enzymes [BR:rec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHECIAT_CH0000644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643496..644548
Genome map
AA seq 350 aa AA seqDB search
MQDSEVIIERRGTAGIIRLNRPRALNSLTLAMIRTITEALDGFARDAEVATVVATGEGER
GFCAGGDIRALHESARAGDGLAGTFWREEFRLNHMIAVYPKPYVALMDGITMGGGVGLSS
HGRHRIVTERTRLAMPETGIGYVPDVGATWLLPKAPGEAGTWLGLTGLDIGAADAIYARL
ADFQIASSRLGEVIESLSGLPRGSSSGDVDSVLQVYAEPPGESRLRQNATMIDHAFRFNS
VEEILAALDSEDGEFAAETRRVLLARSPTSLKLALQLLRAGRRSASLAECLGRELGACLK
MLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVKAETVEKFLKPAEPPLLL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacagcgaagtcatcatcgagcggcgaggcactgccggcatcatccggctcaac
cggccgcgggcgctgaacagcctgacgctggcgatgatccggacgatcaccgaggcgctg
gatggctttgcccgcgatgccgaggtggcgactgtcgtggcaacaggggagggcgaacgc
ggtttctgcgccggcggcgatatccgcgccctgcatgagagcgcccgggccggcgacggc
ctcgccggaaccttctggcgggaagaattccgtctcaaccatatgatcgccgtctacccc
aaaccctatgtcgcgctgatggacggcatcaccatgggcggcggcgtcggcctgtcctcg
cacggccgccaccgtatcgtcaccgagcgcacgcgtcttgccatgccggaaaccggcatc
ggctacgtccccgatgtcggcgccacctggttgctgccgaaggcacccggcgaggccgga
acatggctcggcctgaccgggctcgatatcggcgcagcggatgcgatctacgcccgcctt
gccgattttcagatcgcctcgtcgcggctcggcgaagtgatcgagagcttatcgggcctg
ccgcgcggcagttcgtcgggcgatgtcgacagcgtcttgcaggtatatgcagagcctccg
ggcgagagccggctgcgacagaacgcgacaatgatcgaccacgctttccgtttcaacagc
gtcgaggagattctggctgcgctcgactcggaggatggcgaatttgccgctgagacgcgc
cgtgtgctgctggcgcgctcgccgaccagcctgaagcttgctttgcagctcttgagggcc
ggccgccgcagcgcctcgctcgccgaatgcctcggccgcgaactcggcgcctgcctgaag
atgctggataatcccgacttcttcgagggcatccgcgccgccgtcatcgataaggaccgc
aatccgaaatggtcgccggcctctgtcgaggccgtgaaggcggaaacggtcgagaaattc
ctgaaaccggccgagccgccgcttttgctctga

DBGET integrated database retrieval system