KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0000795Help
Entry
RHECIAT_CH0000795 CDS       T00720                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0000795 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RHECIAT_CH0000795 (aceA)
Enzymes [BR:rec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RHECIAT_CH0000795 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790358..791647)
Genome map
AA seq 429 aa AA seqDB search
MTEFYKLVQNAPAGRFDGIERPYSAADVQRLRGSVALSHTLAEMGADRLWRLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRLNRT
LQRADQIETSEGNGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYEAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLEQARRFAEGVHKA
HPGKLLAYNCSPSFNWKKNLDEATIAKFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQEAEFAAEDYGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHDSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacggaattttacaagcttgtccaaaacgcaccggcgggccgcttcgacggcatcgag
cggccctactcggccgccgatgtgcagcggctcagaggctcggtggcgctcagccatacg
ctggccgaaatgggggcggaccggttgtggcggctgctccaccaggaggatttcgtcaat
gcgctcggcgcactctccggcaaccaggcaatgcagatggtgcgcgccgggctgaaggcg
atctatctctccggctggcaggtggcggccgacgccaatacggcatcggcgatgtatccc
gaccagtcgctttatcccgccaatgccgggccggagcttgccaaacgcctcaaccgcacc
ctgcagcgcgccgatcagatcgagacatcggaaggtaacgggctttccgtcgacacctgg
ttcgcgccgatcgtcgccgatgccgaagccggcttcggcggaccgctcaacgccttcgag
atcatgaaggcctatatcgaggcgggtgctgccggcgtccatttcgaggaccagctcgcc
tcggagaagaaatgcggccatctcggcggcaaggtgctgatcccgacggccgcccatatc
cgcaatctcgacgccgcccggcttgccgccgacgtcatgggcgtggcgacgctggtgatc
gcccggaccgatgcggaagcggcaaagctcttgacctccgacatcgacgagcgcgaccag
cccttcgtcgattacgaggccgggcgcaccgtcgaaggcttctaccaggtcagaaacggc
atcgaaccgtgcatcgcccgggccgtcgcctatgcgccgcattgcgacctgatctggtgc
gagacttccaagccggatctcgagcaggcgcgccgttttgccgagggtgtgcacaaggcc
catcccggcaagctgctcgcctataattgctcgccttccttcaactggaagaagaacctg
gacgaggcgacgattgccaagttccagcgtgaactcggggcgatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgaactggcgcgcggc
taccggcagcggcagatgtcggcctattccgagctgcaggaggcggaattcgccgcagag
gactacggctataccgccaccaaacatcagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcgtcgaccacggcgatgcacgattcaaccgaa
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system