KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001013Help
Entry
RHECIAT_CH0001013 CDS       T00720                                 

Gene name
matA
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHECIAT_CH0001013 (matA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHECIAT_CH0001013 (matA)
Enzymes [BR:rec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     RHECIAT_CH0001013 (matA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1029114..1030538
Genome map
AA seq 474 aa AA seqDB search
MPEASFFTDMLQSITDHGRQLLFSGSRNAQAAAKVDFQTLCEMLLSSRGEASGIALAAEI
LDRWGALESEGAQAFFHMLHETFGPDTERLDQALEHYRTDKSSAAAIALHQAAEPRRQEL
LRRLNHAPNGTARLVRMRQQLLASKDRSEAYQALDADFTHLFGSWFNRGFLTLRPIDWST
PAYILEKIIKYEAVHEIAGWEELRRRLAPADRRCFAFFHPRLADEPLVFVEVALTRSVPK
AIADVLDEGREQINADEATTAVFYSISNCQDGLRGISFGNFLIKQVVEDLRKDLPGLKNF
VTLSPVPGFARWLARMRAATGDASLSEAALKTLTLLDDPDWPDNESSAADVERVLLPLAA
RYFLTERTPEGRPVDPVARFHLGNGARLERVNFLGDRSPKAMQQAHGVMVNYLYKLDDIV
ANHEALAQRGEVIASPAVKNLLNQNDEGRRGGNGQQGSRAFAQLMNSKLGGGRK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcgtctttcttcaccgacatgctgcagagcatcacggatcacggccgccag
cttctgttttccggctcgcgtaatgcgcaggccgcagccaaagtcgatttccagacgctc
tgtgaaatgctgttgtcgagccggggtgaggcatctggcatcgcccttgcggccgagatc
ctcgatcgctggggcgcgctcgaaagcgagggcgcgcaggccttcttccatatgctgcac
gaaacattcgggcctgacacggaaaggctcgaccaggcgcttgaacattaccgcaccgac
aaaagttcggccgcggccattgcgctgcatcaggcggcggagccgcggcggcaggagctc
ctgcgccgattgaatcacgcgccgaacggcaccgccaggctcgtgcgcatgcgtcagcag
ttgcttgcttccaaggaccggtccgaagcctatcaggcgcttgacgccgacttcacgcat
ctgttcggctcctggttcaatcgcggctttctgacgctgcggcccatcgactggtcgacg
ccggcctacattctcgaaaagatcatcaaatacgaggccgtgcacgagattgccggctgg
gaggaattgcgccgtcgtctggcgccggccgaccgtcgatgctttgcctttttccacccg
cggctggccgatgagccgctcgtcttcgttgaagtggcgctcacccgctccgtgccgaag
gcgatcgcagatgttctcgacgaggggcgggagcagatcaatgccgacgaggcgacgacg
gccgtcttctattcgatctccaactgccaggatggcttgcgcggcatctccttcggcaat
ttcctgatcaagcaggtcgttgaagatctgcgcaaggacctgccgggcctcaagaacttc
gtcacgctatcgcccgtcccgggttttgcacgttggcttgccaggatgcgcgccgcgacc
ggcgatgcatctctatccgaagcggcgttgaaaacgctgaccttgctcgacgatccggac
tggcccgacaacgagagcagcgcggccgatgtggagcgcgtgctgctgccgcttgcggcc
cgctacttcctgaccgaacgcacgccggagggccgtccggtcgatcccgtcgcccgcttc
catctcggcaatggcgcccggcttgaaagagtgaatttcctcggcgatcgctcgccgaag
gcgatgcagcaggcgcacggtgtgatggtcaactatctctacaagctcgacgacatcgtc
gccaaccacgaggccttggcgcagcgcggcgaagtcatcgcatcgcctgcggtcaagaac
ctgctcaaccagaacgacgaaggccgccgcggcggcaatggccagcaaggctctcgagcc
tttgcgcaactgatgaattccaagcttggaggagggcgaaagtga

DBGET integrated database retrieval system