KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001074Help
Entry
RHECIAT_CH0001074 CDS       T00720                                 

Gene name
thrC
Definition
(GenBank) threonine synthase protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00260  Glycine, serine and threonine metabolism
rec00750  Vitamin B6 metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01230  Biosynthesis of amino acids
Module
rec_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_CH0001074 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHECIAT_CH0001074 (thrC)
Enzymes [BR:rec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHECIAT_CH0001074 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACE90059
UniProt: B3PSD7
Position
complement(1083937..1085361)
Genome map
AA seq 474 aa AA seqDB search
MTNVDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPAATFRAMIDEAYATFRHPAITPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSTSSNVHALAVEGNFDDCQNLVKAMFNDAAFRDKVSLSGVNSINWARIMAQIVYYFTT
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSNGFEIGGQALKAIRRD
FRAGRASESQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPV
AVKSACGIDPALPTWLADLMHREERFQIIAPELKAVETFIGKHARGKTTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtggattatatctcgacccgcggcgaggcccctgccctcggcttttgcgac
gccctgctgacgggactggcgcgcgatggcgggctctatgttccccgggagtggccgcaa
ttttcgaagaaggagatccgcgcgctgaggggcaagacctatcaggagatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgcagcgaccttccgggcgatgatcgac
gaggcctacgccaccttccgccatccggcgatcacgccgctcgtccagaccgggccgaac
agcttcgtcatggagctgttccacggcacgacgctcgccttcaaggacgtggcgatgcag
ctgctcgcccggctgatggattatgcgctggaaaaacgcggcgagcgggcgacgatcgtt
ggcgccacctcgggcgacaccggcggggcggcgatcgacgcctttgccgggcgcgagcgc
accgatatcttcattctgttcccgcacggcaaggtctcgccggtgcagcagcggcagatg
accacctcgacgtcgtcaaatgtgcatgcgctcgccgtcgaaggcaatttcgacgactgc
cagaatctcgtcaaggccatgttcaacgacgcggcgttccgcgacaaggtcagcctgtcg
ggcgtcaactcgatcaactgggcgcgcatcatggcccagatcgtctattatttcactacc
gccgtggcgctcggcgggccggaccggaagatctcgtttacggtgccgaccggcaatttc
ggcgatatcttcgcgggctactgcgccaagcgcatgggcctgccgatcgaccggctggtg
atcgccaccaacgagaacgacattctcgcccgcacgctgaagaccggccgctacgacatg
aaggcggtcaaggcgacgagctcgccgtcgatggacatccagatctcctcgaatttcgag
cggctgctgttcgaagcctatgggcgtgacgcctcgaaggtgcgcgcggcgatggaaagc
ctgaagcaatccaatggtttcgagatcggcgggcaggcgctgaaggcgatccgccgcgac
ttccgcgccgggcgcgccagcgaaagccaagtcgccgagacgatccgcaagacccatgcg
gaaaccggctatctcctcgatccgcactcggcgatcggcgtcttcgtcgcggccaagaaa
gaaaagccgaatacgccgatggtgacgctttcgaccgcccatccggcgaaatttccggtt
gccgtaaaatcggcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatg
cacagggaggagcgtttccagatcatcgcaccggagctgaaagccgtagagacctttatc
ggcaaacacgcccgcggcaagacgacggcaggcgcagaaagatag

DBGET integrated database retrieval system