KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001074Help
Entry
RHECIAT_CH0001074 CDS       T00720                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rec01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rec00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:rec00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083937..1085361)
Genome map
AA seq 474 aa AA seqDB search
MTNVDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPAATFRAMIDEAYATFRHPAITPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSTSSNVHALAVEGNFDDCQNLVKAMFNDAAFRDKVSLSGVNSINWARIMAQIVYYFTT
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSNGFEIGGQALKAIRRD
FRAGRASESQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPV
AVKSACGIDPALPTWLADLMHREERFQIIAPELKAVETFIGKHARGKTTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtggattatatctcgacccgcggcgaggcccctgccctcggcttttgcgac
gccctgctgacgggactggcgcgcgatggcgggctctatgttccccgggagtggccgcaa
ttttcgaagaaggagatccgcgcgctgaggggcaagacctatcaggagatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgcagcgaccttccgggcgatgatcgac
gaggcctacgccaccttccgccatccggcgatcacgccgctcgtccagaccgggccgaac
agcttcgtcatggagctgttccacggcacgacgctcgccttcaaggacgtggcgatgcag
ctgctcgcccggctgatggattatgcgctggaaaaacgcggcgagcgggcgacgatcgtt
ggcgccacctcgggcgacaccggcggggcggcgatcgacgcctttgccgggcgcgagcgc
accgatatcttcattctgttcccgcacggcaaggtctcgccggtgcagcagcggcagatg
accacctcgacgtcgtcaaatgtgcatgcgctcgccgtcgaaggcaatttcgacgactgc
cagaatctcgtcaaggccatgttcaacgacgcggcgttccgcgacaaggtcagcctgtcg
ggcgtcaactcgatcaactgggcgcgcatcatggcccagatcgtctattatttcactacc
gccgtggcgctcggcgggccggaccggaagatctcgtttacggtgccgaccggcaatttc
ggcgatatcttcgcgggctactgcgccaagcgcatgggcctgccgatcgaccggctggtg
atcgccaccaacgagaacgacattctcgcccgcacgctgaagaccggccgctacgacatg
aaggcggtcaaggcgacgagctcgccgtcgatggacatccagatctcctcgaatttcgag
cggctgctgttcgaagcctatgggcgtgacgcctcgaaggtgcgcgcggcgatggaaagc
ctgaagcaatccaatggtttcgagatcggcgggcaggcgctgaaggcgatccgccgcgac
ttccgcgccgggcgcgccagcgaaagccaagtcgccgagacgatccgcaagacccatgcg
gaaaccggctatctcctcgatccgcactcggcgatcggcgtcttcgtcgcggccaagaaa
gaaaagccgaatacgccgatggtgacgctttcgaccgcccatccggcgaaatttccggtt
gccgtaaaatcggcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatg
cacagggaggagcgtttccagatcatcgcaccggagctgaaagccgtagagacctttatc
ggcaaacacgcccgcggcaagacgacggcaggcgcagaaagatag

DBGET integrated database retrieval system