KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001074Help
Entry
RHECIAT_CH0001074 CDS       T00720                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RHECIAT_CH0001074 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_CH0001074 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHECIAT_CH0001074 (thrC)
Enzymes [BR:rec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RHECIAT_CH0001074 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083937..1085361)
Genome map
AA seq 474 aa AA seqDB search
MTNVDYISTRGEAPALGFCDALLTGLARDGGLYVPREWPQFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPAATFRAMIDEAYATFRHPAITPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSTSSNVHALAVEGNFDDCQNLVKAMFNDAAFRDKVSLSGVNSINWARIMAQIVYYFTT
AVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYGRDASKVRAAMESLKQSNGFEIGGQALKAIRRD
FRAGRASESQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPV
AVKSACGIDPALPTWLADLMHREERFQIIAPELKAVETFIGKHARGKTTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtggattatatctcgacccgcggcgaggcccctgccctcggcttttgcgac
gccctgctgacgggactggcgcgcgatggcgggctctatgttccccgggagtggccgcaa
ttttcgaagaaggagatccgcgcgctgaggggcaagacctatcaggagatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgcagcgaccttccgggcgatgatcgac
gaggcctacgccaccttccgccatccggcgatcacgccgctcgtccagaccgggccgaac
agcttcgtcatggagctgttccacggcacgacgctcgccttcaaggacgtggcgatgcag
ctgctcgcccggctgatggattatgcgctggaaaaacgcggcgagcgggcgacgatcgtt
ggcgccacctcgggcgacaccggcggggcggcgatcgacgcctttgccgggcgcgagcgc
accgatatcttcattctgttcccgcacggcaaggtctcgccggtgcagcagcggcagatg
accacctcgacgtcgtcaaatgtgcatgcgctcgccgtcgaaggcaatttcgacgactgc
cagaatctcgtcaaggccatgttcaacgacgcggcgttccgcgacaaggtcagcctgtcg
ggcgtcaactcgatcaactgggcgcgcatcatggcccagatcgtctattatttcactacc
gccgtggcgctcggcgggccggaccggaagatctcgtttacggtgccgaccggcaatttc
ggcgatatcttcgcgggctactgcgccaagcgcatgggcctgccgatcgaccggctggtg
atcgccaccaacgagaacgacattctcgcccgcacgctgaagaccggccgctacgacatg
aaggcggtcaaggcgacgagctcgccgtcgatggacatccagatctcctcgaatttcgag
cggctgctgttcgaagcctatgggcgtgacgcctcgaaggtgcgcgcggcgatggaaagc
ctgaagcaatccaatggtttcgagatcggcgggcaggcgctgaaggcgatccgccgcgac
ttccgcgccgggcgcgccagcgaaagccaagtcgccgagacgatccgcaagacccatgcg
gaaaccggctatctcctcgatccgcactcggcgatcggcgtcttcgtcgcggccaagaaa
gaaaagccgaatacgccgatggtgacgctttcgaccgcccatccggcgaaatttccggtt
gccgtaaaatcggcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatg
cacagggaggagcgtttccagatcatcgcaccggagctgaaagccgtagagacctttatc
ggcaaacacgcccgcggcaagacgacggcaggcgcagaaagatag

DBGET integrated database retrieval system