KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001188Help
Entry
RHECIAT_CH0001188 CDS       T00720                                 

Definition
phage-related lysozyme protein (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rec  Rhizobium etli CIAT 652
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189198..1189662
Genome map
AA seq 154 aa AA seqDB search
MANRLQRGSAAAAMAVALVGSFEGLRQNAYPDPATGGQPWTICYGSTNGVKPGDRRTVEQ
CKALLALELQTYARGIESCVRVPLPDARFVALTSFAYNVGVKAACGSSAVRLINQGRTAE
GCEALLKWNRAAGITFPGLTRRRQKERAFCLEGV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccgccttcagaggggtagtgctgcggccgccatggccgtggcgcttgtcggc
agtttcgaggggctgcggcagaatgcctatccggatccggcgaccgggggccagccctgg
acgatctgttatggcagcaccaatggcgtgaaacccggggatcgcaggacggtggagcag
tgcaaggcgctgctggcgctggagcttcagacctatgcacgcggcatcgaaagctgtgtg
cgcgtgccgttgccggatgcgcgtttcgtggcgctgacctcgtttgcctacaatgtcggc
gtcaaggcggcctgcggttcgagcgctgtccggctgatcaatcagggcaggacggccgag
ggctgcgaggcgctgttgaagtggaaccgtgccgccggcatcacctttcccggcctgacg
cgccgccggcagaaggaacgcgccttctgcctggagggcgtctga

DBGET integrated database retrieval system