KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001280Help
Entry
RHECIAT_CH0001280 CDS       T00720                                 

Definition
(GenBank) probable alcohol dehydrogenase protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00010  Glycolysis / Gluconeogenesis
rec00071  Fatty acid degradation
rec00350  Tyrosine metabolism
rec00625  Chloroalkane and chloroalkene degradation
rec00626  Naphthalene degradation
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0001280
  Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_CH0001280
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHECIAT_CH0001280
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHECIAT_CH0001280
   00626 Naphthalene degradation
    RHECIAT_CH0001280
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHECIAT_CH0001280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Urocanase Methyltransf_11 UDPG_MGDP_dh_N 2-Hacid_dh_C Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ACE90261
UniProt: B3PTK1
Position
complement(1269598..1270638)
Genome map
AA seq 346 aa AA seqDB search
MKAMYYEAFEQAPEIRTLPDPTPTEDGVVISVGASGLCRSDWHGWMGHDPDIRLPHVPGH
ELAGRVVATGRGVMRFKVGDRVTVPFVSGCGHCSECHSGNQQVCPNQFQPGFTHWGSFSE
YVAIDYADTNLVHLPDTIDDATAASLGCRFATSFRAVADHARTGPGEWIAVHGCGGVGLS
AIMIATALGANAIGIDISEEKLAFARECGAVATVNAASVADVAEAVREITKGGAHVSIDA
LGHPATCFNSIKNLRRRGRHVQVGLMLGEYATPQIPMAQVISNELEIYGSHGMQAWRYDA
MLSMLAAGKIAPQKLIGRRISLEEAVPALMALDKAEGTGISVITQF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgtattatgaagccttcgagcaggcgcccgaaatccgcaccctgcccgat
ccgaccccgactgaggatggcgtcgtcatctccgtcggcgccagcggcctctgccgcagc
gactggcacggctggatgggacacgatcccgatatccggctgccgcatgtgcctggacac
gagcttgccgggcgggtcgtcgccaccggccgcggcgtgatgcgcttcaaggtcggcgac
cgggtcaccgtgcccttcgtttccggctgcggccattgcagtgaatgccattccggcaac
cagcaggtctgcccgaaccagtttcagccgggcttcacccattggggctccttctccgaa
tatgtggcgatcgattatgccgacaccaatctggtgcacctgccggatacgatcgacgat
gcgacggcggcaagtctcggctgccgcttcgccacttcgtttcgcgccgtcgccgaccat
gcgcgcaccggacccggcgaatggatcgccgtgcatggctgcggcggcgtcggcctgtcg
gcgatcatgatcgccaccgcgcttggcgccaatgcgatcggcatcgacatatcggaggag
aaactcgccttcgccagagagtgcggcgcggtggcgacggtcaatgccgcaagcgttgcc
gacgtggccgaggcggtccgcgaaatcaccaaaggcggcgcgcatgtctcgatcgacgcg
ctcggccatcccgccacctgcttcaactcgatcaagaatctgcgccggcgcggccggcat
gtgcaggtggggctgatgctcggcgaatatgcgacgccgcaaatcccgatggcgcaggtg
atcagcaacgaactggagatctacggcagccacggcatgcaggcctggcgctacgacgcc
atgctgtcgatgctggccgccggcaagatcgcgccgcagaagctgatcggaaggcgcatc
agcctggaggaagccgtgccggcgctgatggcgctcgacaaggcggagggcacggggatc
agcgtgatcacgcaattctag

DBGET integrated database retrieval system