KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001525Help
Entry
RHECIAT_CH0001525 CDS       T00720                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rec00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rec00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:rec03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:rec03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rec03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1510428..1510877
Genome map
AA seq 149 aa AA seqDB search
MTDILFYHLTETRLEDALPPLIDKSVERGWRVAVQTREPARRDALDAHLWTYREESFLPH
GTDEADFAESQPVLLTVTSDNANAATVRFIVDGAEPPPADPYERIVFMFDGHDQAQLEAA
RAQWKRLKGEGHNLTYWQQTPEGRWEKKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacattctcttctatcatctgaccgaaaccaggctggaagacgcgcttccgccg
ctcatcgacaaaagcgtcgagcgcggctggcgcgtcgccgtccagacgcgtgagccggcg
cggcgcgatgctctcgatgcgcatctttggacgtaccgcgaagagagcttcctgccgcac
ggcaccgacgaggccgatttcgccgagagccagccggtgcttctgacggtgacgtcggac
aacgccaatgcggcgacggtgcgtttcatcgtcgacggcgccgagccgccgccggcagac
ccttacgagcgcatcgttttcatgttcgacggtcacgatcaggcgcaactggaagcagcg
cgggcgcaatggaagaggctgaaaggcgaggggcataacctcacctactggcagcagacg
ccggaaggacggtgggagaagaaggcctga

DBGET integrated database retrieval system