KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001585Help
Entry
RHECIAT_CH0001585 CDS       T00720                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00521  Streptomycin biosynthesis
rec00523  Polyketide sugar unit biosynthesis
rec01130  Biosynthesis of antibiotics
Module
rec_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RHECIAT_CH0001585 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHECIAT_CH0001585 (rfbC)
Enzymes [BR:rec01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RHECIAT_CH0001585 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACE90563
UniProt: B3PVC2
Position
complement(1575542..1576120)
Genome map
AA seq 192 aa AA seqDB search
MRIETVAIEGIVAITPPRFGDHRGYFSEVFKDAWFRENVADVTFVQDNESLSAQAGTVRG
LHFQISPFAQGKLVRCLAGRIMDVVVDIRVGSPSYGEWLSQELSPETGKQLWIPAGFAHG
FATIEPNSVISYKVTAPYSPQHDRGIAWNDPAIGIRWPFDERDMVSSDKDKTLPRLADLP
SHFSYSAQQPQD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgagaccgtggccatcgagggcattgttgcaatcacgccgccacgtttcggc
gatcatcgcggctacttctccgaggtattcaaagatgcctggttccgagaaaatgtggcc
gatgtcacgttcgtccaggataatgaatcgctttcggcgcaggccggcaccgtccggggg
cttcatttccagatatcgcccttcgcccagggcaagctggtgcgctgccttgccggccgg
atcatggatgtcgtcgtcgacatccgcgtgggatcaccgagctacggcgaatggctctct
caggagctctcgccggaaaccggcaagcagctctggataccggccggtttcgcacacgga
ttcgcaacgatcgagccgaacagcgtcatcagctacaaggtaaccgcaccctacagcccg
cagcacgatcggggcatcgcgtggaacgatccggcgatcggcattcgctggcccttcgat
gagagagacatggtatcgtccgacaaggacaagacgctgccgcggctcgccgatctgcca
agccatttttcctattcagcacagcaaccccaggattga

DBGET integrated database retrieval system