KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001612Help
Entry
RHECIAT_CH0001612 CDS       T00720                                 

Gene name
celC
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1605186..1606232
Genome map
AA seq 348 aa AA seqDB search
MRLWRALLVAATAMLAPAIPPAVAQQAMINADAWSAYKSKFLDPSGRIIDNGNGNISHSE
GQGYGMLLAYLSASPADFEQIWYFTRTELLLRDDGLAVWKWDPNVKPHVTDTNNATDGDM
LIAYALALAGTQWNRNDYILAASRMAEALLAKTVARSAGQMLLLPGSEGFTAADRKDGPV
VNPSYWIYEAIPVMAALAPSDAWKELSDDGVALLKTMQFGPRKLPAEWVSLSGPPRPAEG
FDAEFAYNALRIPLYLARGGITDKALLTRLRKGMSQDGIPATIDLTTGRPKTVLSDPGYR
IVNDVVACVVDGTKLPSSALQFAPTLYYPSTLQLLGLAYIGEKHPECL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgtggcgcgcgctcctcgttgcggcgacggccatgctcgcccccgcaatcccg
ccggccgtcgcccagcaggcgatgatcaatgccgatgcatggtccgcctacaagtcgaag
tttctcgatccgagcggtcgtatcatcgataacggcaacggcaatatcagccacagcgag
gggcagggctatggcatgctgctcgcctatctctcggcaagccccgccgatttcgagcag
atctggtattttacccgcaccgaactcttgttgcgcgacgatggcctggccgtgtggaaa
tgggatccgaacgtcaagccgcatgtcaccgacaccaacaatgccaccgacggcgatatg
ctgatcgcctatgcgctggcgcttgccggcactcagtggaaccgcaacgactatatcctg
gccgcctcccgtatggccgaggcgctgctcgccaaaacagtcgcgcgctcggccggccaa
atgctgctgctgccgggcagcgaaggtttcaccgccgctgaccgcaaggacggccccgtc
gtcaacccttcctactggatctatgaggcaattccggtgatggccgcacttgccccgtcg
gatgcctggaaagagctgtcggatgatggcgtcgcattgttgaagacgatgcagttcggt
ccgcgcaagcttcctgccgaatgggtcagcctcagcggcccgccgcggccggcggagggt
ttcgacgccgaattcgcctataacgcccttcgcattccgctctatctcgcgcgtggcggc
attacagacaaggcgctgctgacccgcctcagaaagggcatgtcgcaggatggcattcca
gccaccatcgatctgaccaccggccggccgaagaccgtgttgtcagaccccggttataga
attgttaacgatgttgtggcctgtgttgtcgatgggaccaagctgccgagctcggcgctg
cagtttgcacccacactctattatccgtccacgcttcaactgctggggctggcctatatc
ggggagaagcatccggagtgtctgtga

DBGET integrated database retrieval system