KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001637Help
Entry
RHECIAT_CH0001637 CDS       T00720                                 

Gene name
speBch1
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RHECIAT_CH0001637 (speBch1)
Enzymes [BR:rec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RHECIAT_CH0001637 (speBch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1631149..1632144)
Genome map
AA seq 331 aa AA seqDB search
MTFHDRKRSSLLANKTIDHAFTATSLTSAASDPTFAGALSFMRRRFTKELSGVDVAVWGI
PFDAATSNRPGTRFGPQAIRRASAIFDNDAQYPFNRELFADMAVVDYGDCLLDYGNHQDT
PGAIERQANVILDSGAFLLTLGGDHYVTWPLLKAHAAKHGPLALVQFDAHQDTWFDEERR
IDHGSFVARATREGIIDPDRSIQIGIRTHAPEDCGINILYGHQVEDMSAGDIASAIITHT
RGAPAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKILSVLQRLHQLDIRGADIVEVSPPYD
HADITAIAGATVAMYMLGLHAERRAIAASQG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttgacctttcacgaccgaaaaaggagctccctcttggcgaacaagaccatcgatcacgcc
ttcacggcgaccagcctcacctctgccgccagcgacccgacctttgccggcgcgctctcc
ttcatgcgccgccgcttcaccaaggaactttccggcgtcgatgtcgccgtctggggtatt
cccttcgacgccgcgacgtcgaaccggccgggcacgcgcttcggcccacaggcaatccgt
cgcgcctcggcgatcttcgacaatgatgcgcaatatcccttcaaccgcgaattgttcgcc
gacatggccgtggtcgattacggcgattgcctgctcgattacggcaatcaccaggatacg
ccgggcgccatcgaacgccaggcgaacgtcatcctcgacagcggcgcttttctgctgacg
ctcggcggcgatcattacgtcacctggccgctgctgaaagcccatgcggcaaaacatggg
ccgctggcgctcgtgcagttcgacgcgcatcaggacacctggttcgacgaagagcggcgc
atcgaccatggctccttcgtcgcgcgggccacccgcgaaggcatcatcgacccggatcgt
tcgatccagatcggcatccgcacccatgcgccggaggattgcggcatcaatattctctat
ggccatcaggtcgaggatatgagtgccggcgacatcgcttcggcaatcatcacccacacg
cgcggcgcgccggcctatctcacctttgatatcgattgcctcgatccggcctttgcgccc
ggcaccggcaccccggtcgccggcggaccgtcgagcgccaagatcctttcggtgctgcag
cgcctgcatcagctcgatatccgcggtgccgatatcgtcgaggtttcgccgccttacgac
cacgccgacatcaccgccattgccggagcaacggtggcgatgtatatgctgggactccat
gcggagcgacgcgccatcgccgcgtcacaaggctga

DBGET integrated database retrieval system