KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001669Help
Entry
RHECIAT_CH0001669 CDS       T00720                                 

Gene name
btuE
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RHECIAT_CH0001669 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RHECIAT_CH0001669 (btuE)
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RHECIAT_CH0001669 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663167..1663733
Genome map
AA seq 188 aa AA seqDB search
MKLEVPVTGNVLDIPVKTVDGRETALNEYKGRVLLIVNVASKCGLTPQYEGLEKLYGEKR
ERGFVVAAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKS
GVKTTGDGPMRERLKSHGIAAGDEDDILWNFEKFLIGRDGKVAARFAPDVTADDSRLVSA
VDKELAKG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaggttcccgtgacgggcaatgtgctggatatcccggtgaagacggtggat
ggtcgtgaaaccgcgctcaacgaatacaagggcagggtgctgttgatcgtcaacgtcgcc
tcgaaatgcgggctcacgccgcaatatgaggggcttgaaaaactttacggcgaaaagcgc
gagcgcggcttcgtcgtcgccgctttccccgccaacgacttcaagggccaggagcccggc
accgacgccgagatcctcgatttctgcaccagcacttacgatgtcaccttcccgatcttc
tcgaagatttcggtgaagggcgaggcccagcacccgctttaccggcagctgaccaaatcc
ggcgtgaagacgaccggcgacggcccgatgcgcgagcgcctgaaatcccacggcatagca
gccggtgacgaggacgatattctctggaacttcgaaaaattcctgatcggccgcgacggc
aaggtggccgcccgattcgcgcctgacgtgacggcggatgattcgcggctggtttcggcc
gtggacaaggaactggcgaagggatga

DBGET integrated database retrieval system