KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001895Help
Entry
RHECIAT_CH0001895 CDS       T00720                                 

Gene name
pcm1
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rec  Rhizobium etli CIAT 652
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879057..1879722
Genome map
AA seq 221 aa AA seqDB search
MMDFEAARAKMVDNQVRTTDVTSHSVLTAFLTVPREAFVPEKAKLLAYVDNDVEISAAAP
GKPARFLMEASPLAKLLQLAAISKDDFVLEVGCGTGYTSALLSIIAGSVIALECDEGLAA
EAKAKLAGYGKVEVVTGPLEKGYAAGAPYDLIFINGAVEEVPAALLGQLRDGGRLVTVEG
HGNAARAKVFVAERGAVSENVFFNASVKPLPGFAKAREFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatggatttcgaagcagcgcgcgcaaagatggtcgacaaccaagttcgcacgacggac
gttacctcgcattccgtgctgacggcgtttctcacggtgccgcgtgaggctttcgtgccg
gagaaggcaaagctgctggcctatgtcgacaacgacgtcgagatctccgctgccgcgccg
ggcaagccggcccgcttcctgatggaggcgtcgccgctcgccaagctgctgcagctggcg
gccatcagcaaggatgatttcgtgctcgaagtcggttgcggcaccggttacacatcggcg
ctgctgtcgatcatcgccggctccgtcattgcgctcgaatgcgacgagggtctggccgcc
gaggcgaaggcaaagcttgccggctacggcaaggtggaagttgtgaccggcccgctcgaa
aagggctacgccgccggcgctccctatgatctgatcttcatcaatggcgctgtcgaggaa
gttccggccgctcttctcggccaattgcgtgatggcggtcgtctggtcacggtcgaaggt
cacggcaatgccgcccgcgccaaggtcttcgtcgccgagcgcggcgccgtttcggagaat
gtcttcttcaatgcttcggtcaagccgctgccgggtttcgccaaggcgcgcgaattcgtt
ttctga

DBGET integrated database retrieval system