KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0001914Help
Entry
RHECIAT_CH0001914 CDS       T00720                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RHECIAT_CH0001914 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1901630..1902283
Genome map
AA seq 217 aa AA seqDB search
MTARLAEKEGFAALVLRLRAEGISDLDLLTAVEQTQRSLFVPAQFADDAYSSRTIPIECG
SFLEGIDFVVRILHHLKLKPGQRVLEIGTGSGFTAAVMGRLAERVLSIDRYKTLTSAAQR
RMESLGLRNVVIRHADGSAGMQGEGTFDRILVTAAFNAMPRFYTDQLVSGGSMIAPLMIS
ENECRMVRLTKTGSRFEREELFEAPYLPIVPRLASLL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgacggcaagactggcggagaaggagggctttgcggcgctcgtcctcagattacgtgcc
gaaggcatctccgacctcgatctgctgacggcggtcgagcagacgcagcgctcgctgttc
gtgccggctcaatttgccgacgatgcctattcgagccgcacgattccgatcgaatgcggt
tcctttctagaaggcatcgattttgtcgtccgcatcctccatcacctgaagctaaagccg
ggccagcgggtcctggaaatcggtaccggcagcggcttcaccgccgccgtcatgggccgc
ctggccgagcgtgtgctgtcgatcgaccgctataagacgctgacatcggcagcgcagcgg
cgcatggaatcgcttggtctgcgcaacgtcgtcatccgccatgccgacggcagcgccggt
atgcagggcgagggcacgttcgaccgtatcctggtgacggcggccttcaacgcgatgccc
cgcttttataccgaccagctcgtttccggcggctcgatgatcgcgccgctgatgatttcc
gaaaacgaatgtcgcatggtgcggttgacgaaaaccggcagccgtttcgaacgcgaggaa
ctgttcgaagccccttatctgccgatcgttccgcgtcttgcctcgctgctgtag

DBGET integrated database retrieval system