KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002032Help
Entry
RHECIAT_CH0002032 CDS       T00720                                 

Gene name
pdhC
Definition
dihydrolipoamide S-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0002032 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0002032 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RHECIAT_CH0002032 (pdhC)
   00620 Pyruvate metabolism
    RHECIAT_CH0002032 (pdhC)
Enzymes [BR:rec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHECIAT_CH0002032 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2010391..2011743
Genome map
AA seq 450 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVAAAAGGAGSPAPAKAEAAPAPKAEAAPAKAEAAPAA
APAAASAAVSAGGNRTFSSPLARRLAREAGIDLSAVAGSGPHGRVVKSDVEAAVAGGGAK
AAAAPAAAAPQAAAAPAPAAAAPKGASEDAVLKLFEPGSYELVPHDGMRKTIARRLVESK
QTIPHFYVSVDCELDALMALRAQLNDAAPRKDGAPAYKLSVNDMVIKAMALALRDVPDAN
VSWTETNMVKHKHADVGVAVSIPGGLITPIIRKAEQKTLSVISNEMRDLGKRAKDRKLKP
EEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKNGEMAIATVMSVTLS
TDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgatacggtcaagtcaggcgatgtgatcgccgagatcgag
actgacaaagcgacgatggaagtcgaagctgtcgatgaaggcaccgtcgccaagctcgtc
gttgccgccggcaccgaaggtgtcaaggtcaacgcgctgatcgccgttctcgccgccgat
ggcgaggatgtcgcagccgccgcaggcggtgcgggttcgcccgctccggcaaaggctgaa
gccgcaccggcgccgaaggccgaggctgcgccggcgaaggctgaggcggctccggctgct
gcgcccgctgccgcatccgcggcagtttctgcaggcggcaaccgcaccttctcttcgccg
cttgcccgcaggctcgcgcgggaagccggcatcgacctttcggcggttgcaggctccggc
ccgcatggtcgcgtcgtcaagagcgatgtcgaagccgccgttgccggcggcggtgcaaaa
gctgccgccgcgccggccgctgctgctccgcaggctgccgcagctccggctccggccgcc
gcagcgccgaagggcgcttccgaggacgccgtactcaagctcttcgagccgggctcctac
gagctcgtgccgcatgacggcatgcgcaagacgatcgcccggcgcctggtcgaatccaag
cagacgatcccgcatttctacgtcagcgtcgattgcgagctcgatgcgctgatggcgctg
cgcgcccagctgaacgatgcggctccccgcaaggacggcgctccggcctacaagctttcg
gtcaacgacatggtcatcaaggccatggcgctggcgctgcgggacgttcccgatgccaac
gtctcctggaccgagaccaacatggtcaagcacaagcacgccgatgtcggcgtcgccgtc
tcgatccccggcggcctgatcaccccgatcatccgcaaggccgagcagaagacgctgtct
gtcatctccaacgagatgcgcgacctcggcaagcgggccaaggaccgcaagctgaagccc
gaagaatatcagggcggcaccagttcggtctccaacatgggcatgatgggcgtcaagaac
tttgccgccgtcgtcaacccgccgcatgcgacgatcctcgcggtcggcgccggcgagcag
cgggtcgtcgtcaagaacggcgaaatggcgatcgctacggtcatgagcgtcacgctgtcg
accgaccatcgctgcgtcgacggcgcgctcggcgccgagctgctccaggccttcaagggc
tacatcgaaaacccgatgggcatgcttgtctaa

DBGET integrated database retrieval system