KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002432Help
Entry
RHECIAT_CH0002432 CDS       T00720                                 

Gene name
folK
Definition
(GenBank) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase protein
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00790  Folate biosynthesis
rec01100  Metabolic pathways
Module
rec_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RHECIAT_CH0002432 (folK)
Enzymes [BR:rec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RHECIAT_CH0002432 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACE91385
UniProt: B3PPV6
Position
complement(2437727..2438239)
Genome map
AA seq 170 aa AA seqDB search
MPEAAWRSATLGLGGNVGEPVKAMAAALQRLDGHDDCRVTAVSRLYRTPPWGKTDQSFFF
NACAAVETRLPPEALLDVCLSIEREMKRERIERWGPRTLDIDVLTYGDVVQEAPRLELPH
PRMTERGFVLMPLADIAPSLVVRGRPVSDWLLDADVTGIEVADDSGAWWA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaggcggcatggcgatccgccaccctcggcctcggcggcaatgtcggcgagccg
gtgaaggcgatggcagcggcgctgcaaaggctggacgggcacgacgattgtcgtgttacc
gccgtgtcgcggctttatcgcacgccgccctggggcaagaccgaccaatcgttcttcttc
aatgcctgcgccgccgtcgaaactcggcttcctccggaagctttgctcgatgtctgtctg
tcgatcgaacgtgagatgaaacgcgagcgtatcgagcgctgggggccgcgtacgctcgat
atcgacgtgctgacctatggcgacgtcgttcaggaggcgccgcggctggaactgccgcat
ccgcggatgaccgagcgcggtttcgtgctgatgccgcttgccgatatcgccccgagcctt
gttgtcagggggcggccggtcagcgactggctgctagacgctgacgtgacgggcatcgag
gtcgccgacgatagcggcgcctggtgggcttga

DBGET integrated database retrieval system