KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002434Help
Entry
RHECIAT_CH0002434 CDS       T00720                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rec00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2438594..2439499)
Genome map
AA seq 301 aa AA seqDB search
MAAFFVINRTSLVIGLEGSLWRVGHGREIELGRRSAIMAIINVTPDSFSDGGRFKTVDAA
VEHALQAVSDGAAIVDIGGESTRPGAAPVSPSEEQARVLPVIEALRGRTQALISIDTYRV
ETAQLAVSAGAHIVNDVSGLQKESGIAELAAATGAGLCIMHTGRDRVKLADVIADQVHFL
ERSLAIAAAAGVNGDRIVLDPGFGFAKETAEENLELMARFSELSRFGLPLLAGTSRKRFL
GTVTGREAADRDVATAATSALLRLQGAAVFRVHNVAINRAALDVADAMLNARQKFERKRP
T
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttttttcgtcatcaataggacaagtctggtgatagggctcgaaggcagttta
tggcgtgtcggccatggccgggagatcgaactcggccgtcgttcggcgatcatggcgatc
atcaacgtgacgccggactccttttccgatggcggacgcttcaaaaccgtcgatgccgcc
gtcgaacacgcgctgcaggcggtgagcgatggcgccgcgatcgtcgacatcggcggcgaa
tcgacccggccgggcgccgcaccggtcagcccttcggaggagcaggcgcgggtgctgccc
gtcatcgaggcattgcgcggccgcacccaggcgctgatatcgatcgacacctatcgcgtc
gagacagcgcagcttgcggtcagcgccggcgcccatatcgtcaacgacgtctccggactg
cagaaggagagcggtatcgcggaactggccgcggcgacaggagcggggctctgcatcatg
cataccggccgcgacagggtcaaacttgccgatgtgatcgccgaccaggtccatttcctc
gaacgatcgcttgcgatcgccgccgcggcaggtgtcaatggtgaccgcatcgtgctcgat
ccgggcttcggcttcgccaaggagacggcagaggagaatctggaactgatggcacggttt
tccgagctttcgcgcttcggcctgccgttgctcgccggcacctcacgcaaacgttttctc
ggcactgtgaccggacgcgaggcggcagaccgggatgtggcgacggctgcgaccagcgcg
ctgctcaggcttcagggagcagcggttttccgggtgcacaatgtcgcaatcaacagggct
gcgcttgatgtcgccgatgctatgctcaatgcgcgccagaaattcgagaggaagcggccg
acatga

DBGET integrated database retrieval system