KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002450Help
Entry
RHECIAT_CH0002450 CDS       T00720                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:rec01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rec01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rec00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:rec00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rec00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460443..2461192
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNIDERAYRQFGDHSVPLTQWGYRQALEAGCVITSYLRGLPDDGFQKL
RIWYSPFLRTRQSKDALLNALPEDFVGDVREDYLLREQDFGLFTEIYDQAERKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMRDGENDDHNIAIVGHGVTNRAV
EMNFLQHPVEWFERSDNPANADITLIEGTRSQGYASILLHRAADRLPGQDGELRDAHGAD
VTITPKLRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctttttctcgttcgccacggcgaatccctcggcaatatcgatgaacgggcctat
cgccagttcggtgatcacagcgtcccactgacgcaatggggctaccggcaggctttggag
gccggctgcgtgatcacatcctatctgaggggattgccggacgacggattccagaagctg
cgcatctggtactcgccgtttctgagaacacgacagagcaaggatgcgttgctcaatgcc
cttccggaagatttcgttggcgatgtcagggaagattatctgctgcgcgaacaggatttc
ggtctcttcaccgaaatttacgaccaggccgaaaggaaacagaagttccccgaagaattc
gaaaaatgggcgcggctgcgcagcaatagcggcaagttttatgcgcgtccacccgatggc
gaaagccgggcggatgtcgcccaacgggttcgcctcttcctccagacggtcatgcgcgac
ggcgagaacgacgaccataacatcgccattgtcggtcatggggttaccaaccgggcggtc
gagatgaacttcctgcagcaccctgttgaatggttcgagcgctccgacaatcccgcaaat
gccgacatcacgctgatcgagggcacgcgctcgcaaggctatgcgtcgatcctgctgcac
cgggcggccgaccggctgcccggacaggatggcgagctgcgcgatgcccatggcgccgac
gtgacgatcacaccaaagcttcgtggctga

DBGET integrated database retrieval system