KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002450Help
Entry
RHECIAT_CH0002450 CDS       T00720                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_CH0002450
   01230 Biosynthesis of amino acids
    RHECIAT_CH0002450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0002450
  Energy metabolism
   00680 Methane metabolism
    RHECIAT_CH0002450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_CH0002450
Enzymes [BR:rec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHECIAT_CH0002450
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHECIAT_CH0002450
  Exosomal proteins of melanoma cells
   RHECIAT_CH0002450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460443..2461192
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNIDERAYRQFGDHSVPLTQWGYRQALEAGCVITSYLRGLPDDGFQKL
RIWYSPFLRTRQSKDALLNALPEDFVGDVREDYLLREQDFGLFTEIYDQAERKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMRDGENDDHNIAIVGHGVTNRAV
EMNFLQHPVEWFERSDNPANADITLIEGTRSQGYASILLHRAADRLPGQDGELRDAHGAD
VTITPKLRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctttttctcgttcgccacggcgaatccctcggcaatatcgatgaacgggcctat
cgccagttcggtgatcacagcgtcccactgacgcaatggggctaccggcaggctttggag
gccggctgcgtgatcacatcctatctgaggggattgccggacgacggattccagaagctg
cgcatctggtactcgccgtttctgagaacacgacagagcaaggatgcgttgctcaatgcc
cttccggaagatttcgttggcgatgtcagggaagattatctgctgcgcgaacaggatttc
ggtctcttcaccgaaatttacgaccaggccgaaaggaaacagaagttccccgaagaattc
gaaaaatgggcgcggctgcgcagcaatagcggcaagttttatgcgcgtccacccgatggc
gaaagccgggcggatgtcgcccaacgggttcgcctcttcctccagacggtcatgcgcgac
ggcgagaacgacgaccataacatcgccattgtcggtcatggggttaccaaccgggcggtc
gagatgaacttcctgcagcaccctgttgaatggttcgagcgctccgacaatcccgcaaat
gccgacatcacgctgatcgagggcacgcgctcgcaaggctatgcgtcgatcctgctgcac
cgggcggccgaccggctgcccggacaggatggcgagctgcgcgatgcccatggcgccgac
gtgacgatcacaccaaagcttcgtggctga

DBGET integrated database retrieval system