KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002479Help
Entry
RHECIAT_CH0002479 CDS       T00720                                 

Definition
sensory box/GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
rec  Rhizobium etli CIAT 652
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2492362..2493429
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELAALGAHAT
QAELDALGAQYFNTSPVRVFDDAHTRISGELDGLLRILKQEQSSLESYTRLLGETHKRIT
SKSNASVELIENAIELLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAVFNNPGMRPVTALLLADIDNFKKINDTYGHPVGDKILATVASVI
RSNVRRDVFVARAGGEEFALIIEGNTAEEVTAIAERIRRTLETTPFKNSRTRVNYGPITV
SIGICMASNAEDAGELYSRADIALYGAKDAGRNCIVLYQDGMQKDFSKSWLIYKA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcaggttcccgatgtcgcgggtcagatcacctat
gccatgcgctcgatgggcgttgccccgataccccgcaactacgaactcttctacgaggcc
tatatcggctccaatcccgcccttacccgagaactggcggcgctcggcgcgcatgcgaca
caggccgaactcgacgcgcttggcgcacaatatttcaacacgagcccagtccgggtcttc
gacgacgcccacacgcgcatatcaggcgagctcgacgggctgctgcggatcctgaagcag
gagcagagctcgctcgaaagctataccagactgctcggcgagacccacaagcgcatcacc
tccaagagcaatgccagcgtcgaactgatcgaaaacgccattgaactgttaagccaagcg
accggagataccatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgttctcag
gagatggatcaagtccgcaaggaactcgatgaatataagcgcatcgccaacaccgactcg
ctgacgcgcctttccaaccgccgtgccttcgacgaccgcctcgccgccgttttcaacaat
ccgggcatgcggccggtgacggccctgctgctcgccgacatcgataatttcaagaagatc
aacgacacctacggccatccagtcggcgacaagattctcgccaccgtcgcctccgtgatc
cgcagcaatgtccggcgcgacgtcttcgtcgcccgcgccggcggtgaggaattcgcgctg
atcatcgagggcaacacagccgaggaagtgacggcgatcgctgagcgcatccgccgaacg
ctcgaaaccaccccgttcaaaaactcccgcacacgggtgaattacggcccgatcaccgtc
tcgatcggaatctgcatggcctcgaatgccgaggatgccggcgagctttacagcagggcc
gacattgccctttacggcgccaaggatgccggtcgcaattgcattgtcctctatcaggac
gggatgcagaaggacttcagcaagagctggctgatctacaaggcctga

DBGET integrated database retrieval system