KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002576Help
Entry
RHECIAT_CH0002576 CDS       T00720                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHECIAT_CH0002576
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_CH0002576
  Lipid metabolism
   00071 Fatty acid degradation
    RHECIAT_CH0002576
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHECIAT_CH0002576
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHECIAT_CH0002576
   00626 Naphthalene degradation
    RHECIAT_CH0002576
Enzymes [BR:rec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHECIAT_CH0002576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2583131..2584159)
Genome map
AA seq 342 aa AA seqDB search
MRALQLIDDRKLEITDLPEPDAPAAGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVEAIGPGVANVLPGQLVSIYGARTCGLCRPCREGRDNLCEHVSGVHGFHLDGFA
QEKVNLPARLLVPAPPGVDAIGAALAPVTFGTVEHMLFDNAKLEPGETILVHAGGSGIGT
AAIQLAKKIGCTVITTVGSDDKIEKAKALGADHVINYRTDRFEGVVRKLTKKKGVDVVFE
HVGKDTWAGSMLCMKRGGRLVTCGSTSGVSTEMNLMMLFQQQLKLLGSFGCRMENMADAM
QKMGRGLVHPVIDTEVGFDDIDRALERMESRQIFGKIILKMD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgctgcaactgatcgatgaccgtaagcttgagatcaccgatctgccggaaccg
gatgcaccggcagccggcgaggtgacgctgcgcgtcaaggccgtggcgctcaaccatatc
gacgtctggggctggcgcggcatggcgtttgccaagcgcaagatgccgctcgtcatcggc
gcggaagcctccggcgtcgtcgaggcgatcgggcccggtgtcgccaacgtgctgccgggt
caactggtgtcgatctacggcgcgcgtacctgcgggctctgccgcccgtgccgcgaaggc
cgcgacaatctctgcgaacacgtttccggcgtgcacggcttccatctcgacggcttcgcg
caggagaaggtcaatctgccggcgcgcctgctcgttccggctcctcccggagtcgatgcg
atcggcgcagcactcgcgcccgttaccttcggcacggtcgaacacatgctgttcgacaat
gccaagctcgaacccggcgaaacgatcctcgtccatgccggcggctccggcatcggcacg
gcggcgatccagcttgccaagaagatcggctgcaccgtcatcaccaccgtcggctccgac
gacaaaatcgagaaggccaaggcgctcggcgccgatcacgtcatcaactaccgcaccgac
cgcttcgaaggcgtagtgcgcaagctcaccaagaagaagggcgtcgacgtcgtcttcgaa
catgtcggcaaggatacctgggcgggttcgatgctctgcatgaagcgcggcggccgcctc
gtcacttgcggttcgacctcgggcgtctcgaccgaaatgaacctgatgatgctgttccag
cagcaattgaagctgctcggctccttcgggtgccgcatggaaaacatggcggatgcgatg
cagaagatgggccgcgggctcgtgcatcccgtcatcgataccgaagtcggcttcgacgat
atcgaccgggcgctggagcggatggaatcgcgccagatcttcggcaagatcatcctgaag
atggattga

DBGET integrated database retrieval system