KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002793Help
Entry
RHECIAT_CH0002793 CDS       T00720                                 

Gene name
lacZ1
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHECIAT_CH0002793 (lacZ1)
Enzymes [BR:rec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RHECIAT_CH0002793 (lacZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2787726..2789711)
Genome map
AA seq 661 aa AA seqDB search
MAEFAWHILEPKLGTYNFDLFDRAISMLGRYGIDTIMCTPTATPPRWLTEAHPEILRVDG
KGRPMSHGSRQHCDTASPVFREHSKRITNAMAEHYRDNPFVVGWQTDNELNTSMPESFSK
ATLSEFQLFLADKYREIAELNRAWGGDFWATAYDSFDQVVLPIEFGPTFPSPGHLQDYHR
FLAFSTARFQHDQVEILRAVKSSWFVFHNLGGLRDIDFRGQFSKDLDFVGYDIYPMLYDE
FMRLGNHAKVQALHLDICRGFSGNYIVPEQQSGFGSQPGFCTLTPEPGELRRMALSSVAH
GADGLMFFRWRPAHFGAEIYWMGIIDHDDIGRHRYEEASRFASEMIALQPKILGTYVRMD
VGIAGSDFDNQEAHKTYPIGLPSPQDDAILMHQYCYDRGIACGFIHPEDDLSRLKLFYVP
HWVMWKDEWTAKLEAFAEAGGTVVIGARTGTRNEDNHVIRETAPGTALSKLTGVRVEDFG
RLAAPGANGLFDVMERSGGLVIPPNKPAESNRRQRRFKLGNRELTAGHFYENLTVEPDVE
VIAAWSNRYAEGQAMATSRKVGKGQVVYLGTYLTPELTEALTERLFAPAGVEPLVGGLPE
GVEVTMRMNDERRLLFVQNYTDQAVTVSGVPAGRDLLDGEKAVRRTLELGGYGCAIVELE
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcgcctggcacattctcgagccgaagctcggcacctacaatttcgatctg
ttcgaccgcgccatatcaatgctcggccgctacggcatcgatacgatcatgtgcacgccg
acggcgaccccgccgcgctggctgacggaggcgcaccctgaaattttaagggtcgacggc
aaaggccggccgatgagccatggctcgcgccagcattgcgacacggcaagcccggtcttc
cgcgagcacagcaagcgcatcaccaatgcaatggccgagcactaccgcgacaaccccttc
gtcgtcggctggcagaccgacaacgagctgaacaccagcatgccggagagcttctccaag
gcgacgctcagcgaattccagctgttcctcgccgacaaataccgcgagatcgccgaactc
aatcgcgcctggggcggtgatttctgggcgacggcctatgacagcttcgatcaggtggtg
ctgccgatcgagttcggcccgaccttcccaagccccggccacctgcaggattaccaccgc
ttcctcgccttctcgacggcgcgcttccagcacgaccaggtggagatcctccgcgcggtc
aaatcctcctggttcgtcttccacaatctcggcggcttgagggatatcgatttccgcggc
cagttcagcaaggatctcgatttcgtcggctacgacatctatccgatgctttatgacgag
ttcatgcggctcggcaaccacgccaaggtgcaggcgctgcatctcgatatctgccgcggc
ttttccggcaattacatcgtgcccgagcagcaatccggcttcggcagccagccgggcttc
tgcacgctgacgccggagccgggggaactgcgccgcatggcgctctcctccgttgctcat
ggtgctgacggcctgatgttcttccgctggcggccggcccatttcggcgccgagatctac
tggatgggcatcatcgaccatgacgatatcggccgccaccgctatgaggaggccagccgc
ttcgcgagcgagatgatcgcgctgcagccgaagatcctcggcacctatgtgcgcatggat
gtcggtatcgccggctcggatttcgacaatcaggaagcccacaagacctatccgatcggc
ctgccgagcccgcaggacgatgcgatcctcatgcatcaatattgctatgatcggggcatc
gcctgcggcttcatccatcccgaggacgatctttccaggctgaagctcttttatgtcccc
cattgggtgatgtggaaggacgaatggacggccaagctcgaagccttcgctgaagcaggc
ggcaccgtcgtcatcggcgcccgcaccggcacccgcaatgaagacaaccacgtcatccgc
gagactgcgccgggcacggcactttcgaagctcaccggcgtgcgcgtcgaggatttcggc
cgcttggccgcccccggcgccaacggcctgttcgacgtcatggaacgctccggcggcctt
gtcataccgccgaacaagccggccgaaagcaaccgccgccagcgccgcttcaagctcggc
aaccgcgaactgaccgccggccacttctacgaaaacctgaccgtcgagcccgacgtcgag
gtgatcgccgcctggtccaaccgctacgccgaagggcaggcgatggcgacctcgcgcaag
gtcggcaaggggcaggtggtctatctcggcacctacctgacgcctgagctgaccgaagcg
ctgaccgaacgcctgtttgcgccggccggcgtagagccgctggtgggcgggctgcccgag
ggcgtggaggtgacgatgcggatgaacgacgagcggcggctgctcttcgtgcagaattat
acggatcaggcggtgacggtgagtggcgtgccggccgggcgggatctgctggatggggag
aaggctgtgcggaggacgctggagcttggcggttatggctgtgcgatcgtggagttggag
gggtga

DBGET integrated database retrieval system