KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002896Help
Entry
RHECIAT_CH0002896 CDS       T00720                                 

Definition
(GenBank) probable glycosyltransferase protein
  KO
K20534  
polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
rec  Rhizobium etli CIAT 652
Brite
Enzymes [BR:rec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     RHECIAT_CH0002896
Lipopolysaccharide biosynthesis proteins [BR:rec01005]
 O-antigen
  RHECIAT_CH0002896
Transporters [BR:rec02000]
 Other Transporters
  Others
   RHECIAT_CH0002896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2892479..2893534)
Genome map
AA seq 351 aa AA seqDB search
MTQAPFLSIVAPCHNEEEGLREFCRRASAAAKSVAGEAFELILVDDGSSDGTWEIISELA
AKVPQVLGVRLLRNHGHQLASTAGLSASRGERILLIDADLQDPPELLLMMMPIMERGADV
VYGQRTRREGETWFKLATASLFYRTLSRLASVTIPRDTGDFRLMRRRVVDILLAMPERDR
FIRGMVSWIGGRQVALPYERDARFAGTTKYPLRKMINFALDAITSFSTTPLRIATWLGMV
SAGVAMALLVYTFVRWLQGETVTGWSSIMAAVSAFSAIQLICIGIIGEYLGRLVQESKKR
PMFMIETILRGGEQAELPTAFSEMGAADKRVALDAAFTSGEPRSKKNSRTG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcaccgtttctttccatcgtcgcgccttgtcacaatgaggaagaggggctg
cgcgaattctgccgccgcgcctctgctgccgcgaagagcgttgccggcgaggcgttcgag
ctcatcctcgtcgacgacggttcctccgacggcacctgggagatcatttcggagctggcg
gctaaagtgccgcaggtgctcggcgtgcgtctgttgcgcaatcacggccaccagctggcg
tcgacggcgggtctttccgcctcgcgcggtgagcgcattctcctgatcgacgccgatctt
caggatccgcccgagctgcttttgatgatgatgccgatcatggagcgcggggccgacgtc
gtctacggccagcgcacccgccgcgaaggcgaaacctggttcaagctcgccaccgcttcg
ctgttctatcgcacgctttccaggctcgcttccgtgaccatcccgcgcgataccggcgat
ttccgtctgatgcgccggcgcgtcgtcgatattctgctggcgatgccggaacgcgatcgc
ttcattcgcggcatggtcagctggatcggcggcaggcaggtggcgctgccctatgagcgc
gacgcgcgttttgccggcacgacgaaatatccgctgcgcaagatgatcaatttcgcgctc
gatgcgatcaccagcttttcgacgacgccgctgcgcatcgccacatggctcggcatggtc
agcgccggtgtcgcgatggcgctgctcgtctataccttcgtgcgctggctgcagggcgag
acggtcaccggctggtcgtcgatcatggccgccgtcagcgccttcagcgccatccagttg
atctgcatcggcatcatcggcgaatatctcggccgtctcgtgcaagagagcaagaagcgc
ccgatgttcatgatcgagaccatcctgcgcggcggcgaacaggccgagctgccgacggcc
ttttcggaaatgggcgccgctgacaagcgcgtagcactggatgcggcctttacctcgggc
gaaccgcgctcgaagaagaacagccggactggatga

DBGET integrated database retrieval system