KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002896Help
Entry
RHECIAT_CH0002896 CDS       T00720                                 

Definition
glycosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2892479..2893534)
Genome map
AA seq 351 aa AA seqDB search
MTQAPFLSIVAPCHNEEEGLREFCRRASAAAKSVAGEAFELILVDDGSSDGTWEIISELA
AKVPQVLGVRLLRNHGHQLASTAGLSASRGERILLIDADLQDPPELLLMMMPIMERGADV
VYGQRTRREGETWFKLATASLFYRTLSRLASVTIPRDTGDFRLMRRRVVDILLAMPERDR
FIRGMVSWIGGRQVALPYERDARFAGTTKYPLRKMINFALDAITSFSTTPLRIATWLGMV
SAGVAMALLVYTFVRWLQGETVTGWSSIMAAVSAFSAIQLICIGIIGEYLGRLVQESKKR
PMFMIETILRGGEQAELPTAFSEMGAADKRVALDAAFTSGEPRSKKNSRTG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcaccgtttctttccatcgtcgcgccttgtcacaatgaggaagaggggctg
cgcgaattctgccgccgcgcctctgctgccgcgaagagcgttgccggcgaggcgttcgag
ctcatcctcgtcgacgacggttcctccgacggcacctgggagatcatttcggagctggcg
gctaaagtgccgcaggtgctcggcgtgcgtctgttgcgcaatcacggccaccagctggcg
tcgacggcgggtctttccgcctcgcgcggtgagcgcattctcctgatcgacgccgatctt
caggatccgcccgagctgcttttgatgatgatgccgatcatggagcgcggggccgacgtc
gtctacggccagcgcacccgccgcgaaggcgaaacctggttcaagctcgccaccgcttcg
ctgttctatcgcacgctttccaggctcgcttccgtgaccatcccgcgcgataccggcgat
ttccgtctgatgcgccggcgcgtcgtcgatattctgctggcgatgccggaacgcgatcgc
ttcattcgcggcatggtcagctggatcggcggcaggcaggtggcgctgccctatgagcgc
gacgcgcgttttgccggcacgacgaaatatccgctgcgcaagatgatcaatttcgcgctc
gatgcgatcaccagcttttcgacgacgccgctgcgcatcgccacatggctcggcatggtc
agcgccggtgtcgcgatggcgctgctcgtctataccttcgtgcgctggctgcagggcgag
acggtcaccggctggtcgtcgatcatggccgccgtcagcgccttcagcgccatccagttg
atctgcatcggcatcatcggcgaatatctcggccgtctcgtgcaagagagcaagaagcgc
ccgatgttcatgatcgagaccatcctgcgcggcggcgaacaggccgagctgccgacggcc
ttttcggaaatgggcgccgctgacaagcgcgtagcactggatgcggcctttacctcgggc
gaaccgcgctcgaagaagaacagccggactggatga

DBGET integrated database retrieval system