KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002911Help
Entry
RHECIAT_CH0002911 CDS       T00720                                 

Gene name
pdxJ
Definition
pyridoxine 5'-phosphate synthase (EC:2.6.99.2)
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Vitamin B6 metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RHECIAT_CH0002911 (pdxJ)
Enzymes [BR:rec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     RHECIAT_CH0002911 (pdxJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2909740..2910492)
Genome map
AA seq 250 aa AA seqDB search
MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI
RNLIDDEFPNAEFNIEGYPTAEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL
TDVVGRLKTMGCRVSLFADGDGDAQAVTIAKAVGADRIELYTGPYGGCYDAPERAAPILE
ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPDLAEVSIGHGLTADALEYGMAETVR
RFCRACGQVV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaagctctccgtgaacctcaatgccatcgccatgctgcgcaaccgacgtgac
ctgccctggccgagcgtcgaagcgctcgggcgaatcgcccttgccgcaggcgccagcggc
ttgaccgtgcatccgcgccccgaccagcgtcacatccgcttttccgacctgccggtcatc
cgcaacctgatcgacgacgaatttccgaatgccgagttcaacatcgaaggttatccgact
gcggagttcctcgatctctgcgccggcgcggcccccgagcaggtgaccttggtgcccgac
gatccctcgcaggcaacttccgaccacggctgggatttccgcaagcaccaggcgttcctg
accgatgtcgtggggcggctgaagacgatggggtgccgcgtctccctctttgccgacggc
gatggggatgcgcaggcggtaacaatcgccaaggcagtcggcgccgatcggatcgaactt
tacaccggcccctatggcggctgctacgacgcgccggaacgggcagcgccgatcctcgaa
gcgcttgggaagaccgcggatgccgcgctcgccatcggccttgccgtcaatgccgggcac
gatctgacggtcgccaacctgccggcattggtgaagcggatcccggatctggccgaagtc
tcgatcggccacggactgaccgccgatgcgctggagtacgggatggccgagacggtgcgc
cggttctgccgggcgtgtgggcaggtggtttga

DBGET integrated database retrieval system