KEGG   Rhizobium etli CIAT 652: RHECIAT_CH0002941Help
Entry
RHECIAT_CH0002941 CDS       T00720                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rec  Rhizobium etli CIAT 652
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rec00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rec00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2938629..2939147)
Genome map
AA seq 172 aa AA seqDB search
MADIRRTIIAAVARNGIIGRDGDMPWRLSSDLKRFKALTLGKPVVMGRKTYDSIGKPLPG
RPNVVISRQAAIDHPDVAMAHSLAEAMDAAERLARETGVDEICIVGGGQIYAQAINLADR
MCITHVEADLDGDASFPDIDPDLWQAAETIAVPAGEKDSYPTRYVVYKRRHA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggccgacattcgcaggaccatcatcgccgccgttgcccgcaacggcatcatcggccgc
gacggcgacatgccgtggcggctgtcgagcgatctcaagcgcttcaaggcgctgacgctg
ggcaagcctgtggtgatgggccgcaagacctacgattcgatcggcaagccgctgccggga
cggccgaacgtggtgatctcgcggcaagcggcgatcgatcatcccgatgtcgctatggcg
cattcgctggccgaggcgatggacgcggctgaaaggctggcgcgcgaaaccggcgtcgac
gagatctgcatcgtcggcggcggtcagatctatgcgcaggcgatcaatcttgccgacaga
atgtgcattacccatgtcgaggccgatctcgacggcgacgcgtcttttcctgacatcgat
cccgatctctggcaggcggcagagacaatcgcggtgccggccggcgagaaggacagctat
cccacccgctacgtcgtctacaaacgtcgccacgcctga

DBGET integrated database retrieval system